var item = new Array();
s=0; item[s]=new Array("accessories_aquapacks_&_dry_cases.html","../images/crewsaverdrycasetmb.jpg","Accessories &#187 Aquapacks & dry cases","£4.95 &#187 Crewsaver Drysaver","Ideal for keeping valuables fully waterproof Durable plastic construction Secure case closure Detachable carry strap Blue 7cm x 4cm x 13.5cm (2.7 x 1.5 x 5)");
s++; item[s]=new Array("accessories_aquapacks_&_dry_cases.html","../images/magicmarinephonedrypockettmb.jpg","Accessories &#187 Aquapacks & dry cases","£6.99 &#187 Magic Marine Phone dry pocket","<ul> <li> Nylon and PVC phone pocket </li> <li>Protects your phone against spray and rain</li> <li>Roll up closure system with velcro quick release buckle</li> <li>Belt clip</li></ul>");
s++; item[s]=new Array("accessories_aquapacks_&_dry_cases.html","../images/aquapackkeykeymastertmb.jpg","Accessories &#187 Aquapacks & dry cases","£9.99 &#187 Aqua Pack Key Master","Aquapac Keymaster Aquapac Quicklink: AQU600 Locked everything in the car? Wondering where to keep the car keys? Well now you can take them with you. The Keymaster, specifically designed to keep car immobilisers safe from water damage, is great for cash and credit cards too. Also an ideal case for keeping asthma inhalers safe. - Ideal for keeping keys, cash and credit cards - Protection for all weather conditions. - Also great for keeping asthma inhalers safe. - Guaranteed 100% waterproof to 50m/150ft!. - Dust and sand proof too - Floats if dropped in water - Supplied with a detachable neck cord.");
s++; item[s]=new Array("accessories_aquapacks_&_dry_cases.html","../images/aquapacsmallphonetmb.jpg","Accessories &#187 Aquapacks & dry cases","£19.99 &#187 Aqua Pack waterproof phone/gps case size small","Aquapac Small Phone/GPS Aquapac Quicklink: AQU110 Protect your phone or GPS from the elements. The thin malleable material of the case means you can also operate your handset as normal through the case without sound being affected. - Use your phone normally - Sound and signal pass right through the case - 100% waterproof to 15ft/5m - Dust and sand-proof too! - Float safely if dropped it in water - Made of tough flexible vinyl with a foam-padded rear for extra comfort and protection - Detachable neck cord - Carabiner for attaching to your belt, your boat. - Desiccant sachet");
s++; item[s]=new Array("accessories_aquapacks_&_dry_cases.html","../images/pelimicrocasetmb.jpg","Accessories &#187 Aquapacks & dry cases","£21.99 &#187 Peli watertight case","1020 Micro Case Interior Dimensions: 13.5 x 9 x 4.3 cm (5.31 x 3.56 x 1.68) Watertight, crushproof, and dust proof Easy open latch Rubber liner for extra protection doubles as o-ring seal Automatic Pressure Equalization Valve - balances interior pressure, keeps water out Stainless steel hardware Lanyard");
s++; item[s]=new Array("accessories_aquapacks_&_dry_cases.html","../images/aquapackprosportsminitmb.jpg","Accessories &#187 Aquapacks & dry cases","£25.00 &#187 Aqua Pack prosport mini garmin 201 compatible","Made with a tough vinyl material the rugged Mini PRO Sports case comes with a neoprene and Velcro® armband to be worn on your arm or your leg, keeping your hands free to enjoy any activity. Ideal for today's smaller phones, GPS and two-way radios.");
s++; item[s]=new Array("accessories_boat_stickers.html","../images/stickerintflagcodestmb.jpg","Accessories &#187 Boat stickers","£2.00 &#187 International flag code sticker","International flag code sticker size 17cm by 10cm");
s++; item[s]=new Array("accessories_boat_stickers.html","../images/stickerportstarboardstickertmb.jpg","Accessories &#187 Boat stickers","£1.00 &#187 Port and Starboard stickers","Dinghy port and starboard sticker.Each sticker 12.7cm by 3.7cm.");
s++; item[s]=new Array("accessories_boat_stickers.html","../images/stickercalibrationlargetmb.jpg","Accessories &#187 Boat stickers","£1.50 &#187 Calibration strip large jonti logo","Dinghy calibration strip .Total length 28.5cm , each increment 2.9cm.");
s++; item[s]=new Array("accessories_boat_stickers.html","../images/calibrationstripsmallrwotmb.jpg","Accessories &#187 Boat stickers","£2.99 &#187 Calibration strip small","Dinghy calibration strips sheet of five .Total length of each strip 13cm , each increment 1cm.");
s++; item[s]=new Array("accessories_boat_stickers.html","../images/optipartscalibrationstriptmb.jpg","Accessories &#187 Boat stickers","£1.25 &#187 Calibration strip medium","Dinghy calibration strip medium .Total length 16.9cm , each increment 1.25cm.");
s++; item[s]=new Array("accessories_car_seat_cover.html","../images/mysticcarseatcovertmb.jpg","Accessories &#187 Car Seat Cover","£27.99 &#187 Mystic car seat cover","Car seat cover");
s++; item[s]=new Array("accessories_foghorns_&_flares.html","../images/flarehandheldtmb.jpg","Accessories &#187 Foghorns & Flares","£7.99 &#187 Flare - handheld. Pains Wessex Red Handflare MK8","<p>Pains Wessex's 100 years of pyrotechnic production has made them world renowned for their reliability and superior quality products. Pains Wessex flares are up to 30 times brighter than its competition. Designed to withstand the toughest of marine environments, hand-held flares are short range distress signals. These distress signals meet the various specifications of the SOLAS, U.S.C.G., and EC-Type Certificates. Description A hand-held red flare designed to withstand exceptional environmental exposure and to perform reliably under extreme conditions. The flare is encased in a steel tube for safety to eliminate damage from burning ashes. For greater operational ease and safety, it is fitted with an integral pull, twist and strike firing mechanism. Additional features of this signal are that waterproofing is achieved without the use of sealing tapes, hence easier operation, and once ignited the flare will continue to operate if immersed in water. </p><ul> <li>SPECIFICATIONS </li> <li>Performance: Burns for 60 seconds at a minimum of 15,000 candela </li> <li>Dimensions: 9.44x1.34 (diameter) </li> <li>Weight: 9.7 oz. Explosive content: 3.52 oz. </li></ul>");
s++; item[s]=new Array("accessories_foghorns_&_flares.html","../images/plastimofoghornsparecannistertmb.jpg","Accessories &#187 Foghorns & Flares","£8.50 &#187 Plastimo foghorn spare 200ml cannister.Non inflammable","");
s++; item[s]=new Array("accessories_foghorns_&_flares.html","../images/plastimofoghorntmb.jpg","Accessories &#187 Foghorns & Flares","£13.99 &#187 Plastimo foghorn complete with 200ml cannister.Non inflammable","");
s++; item[s]=new Array("accessories_knives_and_tools.html","../images/magicmarinesafetyknifetmb.jpg","Accessories &#187 Knives and tools","£7.49 &#187 Magic marine safety knife","<p>To be used as as an emergency knife only and not for general useage.</p><p> Supplied with a pouch, the Magic Marine knife can be kept in a bouyancy aid   pocket or fitted to a trapeze harness. </p><p><br></p><p><object width=425 height=344>    <param name=movie value=http://www.youtube.com/v/noSkZkTJs4c&hl=en_GB&fs=1&>    <param name=allowFullScreen value=true>    <param name=allowscriptaccess value=always>    <embed src=http://www.youtube.com/v/noSkZkTJs4c&hl=en_GB&fs=1& type=application/x-shockwave-flash allowscriptaccess=always allowfullscreen=true width=425 height=344>    </embed>  </object> </p><p>&nbsp</p>");
s++; item[s]=new Array("accessories_knives_and_tools.html","../images/rwoshacklekeytmb.jpg","Accessories &#187 Knives and tools","£2.99 &#187 RWO Shackle key and multitool 11cm by 1.8cm","");
s++; item[s]=new Array("accessories_knives_and_tools.html","../images/ronstanshacklekeytmb.jpg","Accessories &#187 Knives and tools","£5.50 &#187 Ronstan Shackle key and screwdriver","Micro size, suits coined head shackle pins up to 6mm (1/4) dia., screwdriver, bottle opener, lanyard included");
s++; item[s]=new Array("accessories_knives_and_tools.html","../images/knifeplastimo36087tmb.jpg","Accessories &#187 Knives and tools","£14.99 &#187 Stainless Steel  Clipper Knife","Shackle key, splicing spike and bottle opener. 7 cm rigid serrated blade for rope and net cutting. Length : 18.5 cm.");
s++; item[s]=new Array("accessories_knives_and_tools.html","../images/knifeplastimo36089tmb.jpg","Accessories &#187 Knives and tools","£12.99 &#187 Stainless Steel  Rubber Handled Knife","8.5 cm st. steel locking blade. Serrated, ideal for rope cuttting. Soft rubber handle allows an excellent grip. Length : 19.5 cm.");
s++; item[s]=new Array("accessories_knives_and_tools.html","../images/knifeplastimo36088tmb.jpg","Accessories &#187 Knives and tools","£9.99 &#187 Stainless Steel   Knife And Various tools","Splicing spike, bottle opener and screwdriver. 7.5 cm rigid st. steel blade. Serrated, ideal for rope cutting. Polyethylene handle. Length : 18 cm.");
s++; item[s]=new Array("accessories_knives_and_tools.html","../images/gerberrivershortyknifetmb.jpg","Accessories &#187 Knives and tools","£32.99 &#187 Gerber River Shorty","<p>There's nothing quite like frothing rapids and the Herculean force of water crashing around boulders to thrill the souls of whitewater rafters. And there's no watersports knife quite like the Gerber River Shorty. Medium-carbon stainless steel is the core material, polished to within an inch of its life to limit corrosion. The blade is 3 inches of river runnin' versatility, with the serrated sharp side aiming up rather than down. The sheath is constructed of a hard plastic, which is perfection in the wet world. It can receive the knife in two ways. And it can be worn on your belt, on your boot, or attached to your floatation vest. </p><ul> <li>Ideal for watersports </li> <li>Corrosion-resistant blade </li> <li>Hard plastic sheath</li> <li>Overall Length: 6.73 </li> <li>Length of Blade: 3.02 </li> <li>Weight: 4 oz. </li> <li>Blade Material: High Carbon Stainless </li> <li>Handle Material: Glass-filled nylon </li> <li>Blade Style: Blunt Tip </li> <li>Sheath Material: Molded Plastic</li> <li> Blade Type: Serrated </li></ul>");
s++; item[s]=new Array("accessories_mast_floats.html","../images/mastfloattmb.jpg","Accessories &#187 Mast floats","£39.99 &#187 Optiparts masthead float","This mast float significantly reduces the risk of inversion. A very neat design of 2 inflatable tubes connected with a piece of sailcloth. The sailcloth can be folded around the rope inside the sailtrack. The mastfloat is hoisted with the sail. Each tube has a length of 80 cm and can contain 4 liter air, so total buoyancy is 8 liter. Please note this product is meant for small dinghies only and does not guarantee 100% protection against inversion. Using it is for own responsibility. The product is inflated by mouth.");
s++; item[s]=new Array("accessories_mast_floats.html","../images/crewsaverlargemastheadfloattmb.jpg","Accessories &#187 Mast floats","£62.50 &#187 Crewsaver 40 litre floats","<ul> <li> Heavy duty fabric construction </li> <li>Greatly reduce the risk of damage and injury caused by capsize and sinking </li> <li>Designed in conjunction with sailing centres in both the UK and abroad</li></ul><p>&nbsp</p>");
s++; item[s]=new Array("accessories_mast_floats.html","../images/crewsavermastfloattmb.jpg","Accessories &#187 Mast floats","£52.99 &#187 Crewsaver 9 litre floats","<ul> <li> Heavy duty fabric construction </li> <li>Greatly reduce the risk of damage and injury caused by capsize and sinking </li> <li>Designed in conjunction with sailing centres in both the UK and abroad</li></ul><p>&nbsp</p>");
s++; item[s]=new Array("accessories_sun_screen.html","../images/prosportsunscreentmb.jpg","Accessories &#187 Sun Screen","£15.99 &#187 Prosport Sunscreen (6 fluid oz/180 ml)","<p>Unique Waterblock System (USA Patent Pending) - that maintains Sun Protection Factor (SPF) even after 8 hours in and out of water </p><p>Apply Today.....Reapply Tomorrow </p><p>As recommended in the Times Newspaper. </p><ul> <li>Clear Not White Speciality sports product - not generally available </li> <li>Highly water resistant and oil free - will not sweat into eyes </li> <li>Provides high protection against sunburn, retains full </li> <li>SPF even after 80 minutes of activity in water and/or sweating </li> <li>Water resistant, UVA/UVB protection, PABA-free, oil free, fragrance </li> <li>Free Water-based so sand will not stick and will not sweat into eyes </li> <li>Field tested in some of the hottest countries in the world. </li> <li>Formulated for outdoor sports professionals, worn daily by surfers, dive masters, sailors, paddlers, lifeguards and contractors on several continents </li></ul>");
s++; item[s]=new Array("accessories_towels.html","../images/crewsaverdrytoweltmb.jpg","Accessories &#187 Towels","£21.99 &#187 Crewsaver Dry Towel","<p>Dry Towel </p><ul> <li>Great space saver </li> <li>Soft, comfortable, quick drying fabric </li> <li>Absorbs up to 4 times its own weight in water</li> <li> Folds up compactly when dry </li> <li>Supplied with zipped bag for easy transportation </li> <li>Towel size: 89cm x 145cm (35 x 57) </li> <li>Towel packed: 26cm x 8cm (10 x 3) </li></ul>");
s++; item[s]=new Array("accessories_towels.html","../images/douglasgilldrytoweltmb.jpg","Accessories &#187 Towels","£19.99 &#187 Douglas Gill Quick dry towel","<p>A super absorbent quick drying towel ideal for life on board. </p><ul> <li>Lightweight and packable, it also has an antibacterial finish. </li> <li>Comes in its own compact mesh carry bag. </li> <li>One Size Grey. 90 by 150cm</li></ul>");
s++; item[s]=new Array("accessories_towels.html","../images/guljoshtoweltmb.jpg","Accessories &#187 Towels","£14.99 &#187 Gul beach towel - Josh print 80 by 160cm","<p>A superb beach towel</p><p>Product Description: </p><ul> <li>The josh cotton velour towel covered from top to bottom in stars. Sweet!! </li> <li>Size 160 by 80cm</li></ul>");
s++; item[s]=new Array("accessories_towels.html","../images/gulflowertoweltmb.jpg","Accessories &#187 Towels","£12.99 &#187 Gul beach towel - flower print 80 by 160cm","<p>A superb beach towel</p><p>Product Description: </p><ul> <li>The flower green cotton velour towel . Sweet!! </li> <li>Size 160 by 80cm</li></ul>");
s++; item[s]=new Array("accessories_watches.html","../images/optimumtime220jltmb.jpg","Accessories &#187 Watches","£39.99 &#187 Optimum sailing watch series 2jl code 220","<ul>Junior/Ladies watch <li> ABS case with integrated soft touch PU strap </li> <li>Heavy Duty stainless steel buckle </li> <li> Start/Stop button on front dial</li> <li> Water resistant to 5ATM</li> <li> Shock Resistant Construction </li> <li>Normal Time keeping mode (12 or 24 hour0 </li> <li>Calendar Function (date/month or month/date) </li> <li>Alarm function </li> <li>Specialist Sailing Timer Functions </li> <li>Countdown repeat option </li> <li>Countdown and up to show elapsed time for handicap races 5.4.1.0. </li> <li>ISAF start sequence pre-programmed with audible warning signals 5 minute, 3 minute and multiples of 1 minute programs as well Sync button for instant synchronisation if a gun is missed Electro-luminescence backlight feature </li></ul>");
s++; item[s]=new Array("accessories_watches.html","../images/optimumtime224jltmb.jpg","Accessories &#187 Watches","£39.99 &#187 Optimum sailing watch series 2jl code 224","<ul>Junior/Ladies watch <li> ABS case with integrated soft touch PU strap </li> <li>Heavy Duty stainless steel buckle </li> <li> Start/Stop button on front dial</li> <li> Water resistant to 5ATM</li> <li> Shock Resistant Construction </li> <li>Normal Time keeping mode (12 or 24 hour0 </li> <li>Calendar Function (date/month or month/date) </li> <li>Alarm function </li> <li>Specialist Sailing Timer Functions </li> <li>Countdown repeat option </li> <li>Countdown and up to show elapsed time for handicap races 5.4.1.0. </li> <li>ISAF start sequence pre-programmed with audible warning signals 5 minute, 3 minute and multiples of 1 minute programs as well Sync button for instant synchronisation if a gun is missed Electro-luminescence backlight feature </li></ul>");
s++; item[s]=new Array("accessories_watches.html","../images/optimumtime227jltmb.jpg","Accessories &#187 Watches","£39.99 &#187 Optimum sailing watch series 2jl code 227","<ul>Junior/Ladies watch <li> ABS case with integrated soft touch PU strap </li> <li>Heavy Duty stainless steel buckle </li> <li> Start/Stop button on front dial</li> <li> Water resistant to 5ATM</li> <li> Shock Resistant Construction </li> <li>Normal Time keeping mode (12 or 24 hour0 </li> <li>Calendar Function (date/month or month/date) </li> <li>Alarm function </li> <li>Specialist Sailing Timer Functions </li> <li>Countdown repeat option </li> <li>Countdown and up to show elapsed time for handicap races 5.4.1.0. </li> <li>ISAF start sequence pre-programmed with audible warning signals 5 minute, 3 minute and multiples of 1 minute programs as well Sync button for instant synchronisation if a gun is missed Electro-luminescence backlight feature </li></ul>");
s++; item[s]=new Array("accessories_watches.html","../images/optimumtime223tmb.jpg","Accessories &#187 Watches","£39.99 &#187 Optimum sailing watch series 2 code 223","<ul> <li> ABS case with integrated soft touch PU strap </li> <li>Heavy Duty stainless steel buckle </li> <li>26mm round displa</li> <li>y Large 10mm digit height Single row display</li> <li> Start/Stop button on front dial</li> <li> Water resistant to 5ATM</li> <li> Shock Resistant Construction </li> <li>Normal Time keeping mode (12 or 24 hour0 </li> <li>Calendar Function (date/month or month/date) </li> <li>Alarm function </li> <li>Specialist Sailing Timer Functions </li> <li>Countdown repeat option </li> <li>Countdown and up to show elapsed time for handicap races 5.4.1.0. </li> <li>ISAF start sequence pre-programmed with audible warning signals 5 minute, 3 minute and multiples of 1 minute programs as well Sync button for instant synchronisation if a gun is missed Electro-luminescence backlight feature </li></ul>");
s++; item[s]=new Array("accessories_watches.html","../images/optimumtimeseries121tmb.jpg","Accessories &#187 Watches","£29.99 &#187 Optimum sailing watch series 1 code 121","<ul> <li> 26mm round display size </li> <li>Large 10mm digit height </li> <li>Single row display </li> <li>Water Resistant to 5 ATM </li> <li>Shock Resistant Construction Normal </li> <li>Timekeeping Mode (12 or 24 Hour) </li> <li>Calendar Function (date/month or month/date) </li> <li>Alarm function (for wake up calls etc) </li> <li>Specialist Sailing Timer Functions: Countdown repeat option or Countdown and Up to show elapsed time for handicap races 5,4,1,0 ISAF start sequence pre-programmed with audible warning signals (can be silenced if preferred). 5 minute, 3 minute and multiples of 1 minute programs aswell </li></ul>");
s++; item[s]=new Array("accessories_watches.html","../images/optimumtimeseries1tmb.jpg","Accessories &#187 Watches","£44.99 &#187 Optimum sailing watch series 3 code 315","<p>Ultimate Sailing Watch</p><ul> <li> - A must for every racing sailor </li> <li>Preprogrammed with 10, 6, 5, 3, & 1 minute countdown </li> <li>Synchronising correction button. I</li> <li>t also counts up when it's finished counting down. </li> <li>Large face is easy to read, Easy to use with large buttons </li> <li>Can be boom mounted as well as worn on the wrist. </li></ul>");
s++; item[s]=new Array("accessories_watches.html","../images/optimumwatchseries336tmb.jpg","Accessories &#187 Watches","£44.99 &#187 Optimum Watch Series 336","<ul> <li> Optimum time OS Series 3 Sailing Watch, with 16mm LCD Display </li> <li>Compact & Comfortable, 5, 4, 1, 0 </li> <li>Start Sequence +5, 3 or 1 minute countdown, </li> <li>Alarm, Water Resistant, </li> <li>Adjustable viewing angle, </li> <li>Boom mounting option, Countdown and up or Countdown and repeat, </li> <li>SYNC button, </li> <li>Positive 'click' buttons, </li> <li>Low battery indicator, 2 row display, time-sailing timer functions </li></ul>");
s++; item[s]=new Array("all_gift_tokens_gift_token.html","../images/gifttokentmb.jpg","All gift tokens &#187 Gift Token","£10.00 &#187 Gift Token","Gift Tokens .Redeemable against goods or lessons.Vouchers will be posted out free of charge.");
s++; item[s]=new Array("all_gift_tokens_gift_token.html","../images/gifttokentmb.jpg","All gift tokens &#187 Gift Token","£25.00 &#187 Gift Token","Gift Tokens .Redeemable against goods or lessons.Vouchers will be posted out free of charge.");
s++; item[s]=new Array("all_gift_tokens_gift_token.html","../images/gifttokentmb.jpg","All gift tokens &#187 Gift Token","£50.00 &#187 Gift Token","Gift Tokens .Redeemable against goods or lessons.Vouchers will be posted out free of charge.");
s++; item[s]=new Array("all_gift_tokens_gift_token.html","../images/gifttokentmb.jpg","All gift tokens &#187 Gift Token","£75.00 &#187 Gift Token","Gift Tokens .Redeemable against goods or lessons.Vouchers will be posted out free of charge.");
s++; item[s]=new Array("all_gift_tokens_gift_token.html","../images/gifttokentmb.jpg","All gift tokens &#187 Gift Token","£100.00 &#187 Gift Token","Gift Tokens .Redeemable against goods or lessons.Vouchers will be posted out free of charge.");
s++; item[s]=new Array("all_gift_tokens_sailing_tuition.html","../images/gifttokensailingtuitiontmb.jpg","All gift tokens &#187 Sailing tuition","£45.00 &#187 Sailing Tuition","Dinghy Sailing individual tuition 1.5 hours.Courses run weekdays only April to September");
s++; item[s]=new Array("all_gift_tokens_sailing_tuition.html","../images/gifttokensailingtuitiontmb.jpg","All gift tokens &#187 Sailing tuition","£85.00 &#187 Sailing Tuition","Dinghy Sailing individual tuition 3 hours.Courses run weekdays only April to September");
s++; item[s]=new Array("all_gift_tokens_sailing_tuition.html","../images/gifttokensailingtuitiontmb.jpg","All gift tokens &#187 Sailing tuition","£115.00 &#187 Sailing Tuition","Dinghy Sailing individual tuition 5 hours.Courses run weekdays only April to September");
s++; item[s]=new Array("blocks_-_harken_16mm_sheave.html","../images/harkenblocks404tmb.jpg","Blocks - Harken &#187 16mm sheave","£10.43 &#187 16mm air block with o ring","");
s++; item[s]=new Array("blocks_-_harken_16mm_sheave.html","../images/harkenblocks405tmb.jpg","Blocks - Harken &#187 16mm sheave","£11.99 &#187 16mm air block w/becket","");
s++; item[s]=new Array("blocks_-_harken_16mm_sheave.html","../images/harkenblocks416tmb.jpg","Blocks - Harken &#187 16mm sheave","£12.15 &#187 16mm cheek air block","");
s++; item[s]=new Array("blocks_-_harken_16mm_sheave.html","../images/harkenblocks432tmb.jpg","Blocks - Harken &#187 16mm sheave","£13.09 &#187 16mm pivoting cheek air block","");
s++; item[s]=new Array("blocks_-_harken_16mm_sheave.html","../images/harkenblocks376tmb.jpg","Blocks - Harken &#187 16mm sheave","£15.03 &#187 16mm forkhead block","");
s++; item[s]=new Array("blocks_-_harken_16mm_sheave.html","../images/harkenblocks442tmb.jpg","Blocks - Harken &#187 16mm sheave","£15.80 &#187 16mm anti capsize block","");
s++; item[s]=new Array("blocks_-_harken_16mm_sheave.html","../images/harkenblocks417tmb.jpg","Blocks - Harken &#187 16mm sheave","£18.93 &#187 16mm swivel air block","");
s++; item[s]=new Array("blocks_-_harken_16mm_sheave.html","../images/harkenblocks391tmb.jpg","Blocks - Harken &#187 16mm sheave","£20.97 &#187 16mmhook-in/sprit block","");
s++; item[s]=new Array("blocks_-_harken_16mm_sheave.html","../images/harkenblocks406tmb.jpg","Blocks - Harken &#187 16mm sheave","£21.80 &#187 16mm double air block","");
s++; item[s]=new Array("blocks_-_harken_16mm_sheave.html","../images/harkenblocks407tmb.jpg","Blocks - Harken &#187 16mm sheave","£23.89 &#187 16mm double air block w/becket","");
s++; item[s]=new Array("blocks_-_harken_16mm_sheave.html","../images/harkenblocks437tmb.jpg","Blocks - Harken &#187 16mm sheave","£27.64 &#187 16mm flip flop block","");
s++; item[s]=new Array("blocks_-_harken_16mm_sheave.html","../images/harkenblocks421tmb.jpg","Blocks - Harken &#187 16mm sheave","£29.10 &#187 16mm exit block","");
s++; item[s]=new Array("blocks_-_harken_16mm_sheave.html","../images/harkenblocks408tmb.jpg","Blocks - Harken &#187 16mm sheave","£30.82 &#187 16mm triple air block","");
s++; item[s]=new Array("blocks_-_harken_16mm_sheave.html","../images/harkenblocks409tmb.jpg","Blocks - Harken &#187 16mm sheave","£32.44 &#187 16mm triple air block w/becket","");
s++; item[s]=new Array("blocks_-_harken_22mm_sheave.html","../images/harkenblocks224tmb.jpg","Blocks - Harken &#187 22mm sheave","£8.81 &#187 single micro block","");
s++; item[s]=new Array("blocks_-_harken_22mm_sheave.html","../images/harkenblocks225tmb.jpg","Blocks - Harken &#187 22mm sheave","£10.17 &#187 single micro block w/becket","");
s++; item[s]=new Array("blocks_-_harken_22mm_sheave.html","../images/harkenblocks233tmb.jpg","Blocks - Harken &#187 22mm sheave","£11.89 &#187 micro cheek block","");
s++; item[s]=new Array("blocks_-_harken_22mm_sheave.html","../images/harkenblocks234tmb.jpg","Blocks - Harken &#187 22mm sheave","£12.67 &#187 single micro block w/shackle","");
s++; item[s]=new Array("blocks_-_harken_22mm_sheave.html","../images/harkenblocks243tmb.jpg","Blocks - Harken &#187 22mm sheave","£12.26 &#187 micro stand up block","");
s++; item[s]=new Array("blocks_-_harken_22mm_sheave.html","../images/harkenblocks235tmb.jpg","Blocks - Harken &#187 22mm sheave","£14.08 &#187 single micro block with shackle and becket","");
s++; item[s]=new Array("blocks_-_harken_22mm_sheave.html","../images/harkenblocks377tmb.jpg","Blocks - Harken &#187 22mm sheave","£14.28 &#187 micro forkhead block","");
s++; item[s]=new Array("blocks_-_harken_22mm_sheave.html","../images/harkenblocks443tmb.jpg","Blocks - Harken &#187 22mm sheave","£14.55 &#187 micro anti capsize block","");
s++; item[s]=new Array("blocks_-_harken_22mm_sheave.html","../images/harkenblocks292tmb.jpg","Blocks - Harken &#187 22mm sheave","£17.58 &#187 micro swivel block","");
s++; item[s]=new Array("blocks_-_harken_22mm_sheave.html","../images/harkenblocks232tmb.jpg","Blocks - Harken &#187 22mm sheave","£19.40 &#187 micro traveller block","");
s++; item[s]=new Array("blocks_-_harken_22mm_sheave.html","../images/harkenblocks242tmb.jpg","Blocks - Harken &#187 22mm sheave","£21.12 &#187 micro thru deck block with coverplate","");
s++; item[s]=new Array("blocks_-_harken_22mm_sheave.html","../images/harkenblocks226tmb.jpg","Blocks - Harken &#187 22mm sheave","£22.11 &#187 double micro block","");
s++; item[s]=new Array("blocks_-_harken_22mm_sheave.html","../images/harkenblocks227tmb.jpg","Blocks - Harken &#187 22mm sheave","£23.89 &#187 double micro block w/becket","");
s++; item[s]=new Array("blocks_-_harken_22mm_sheave.html","../images/harkenblocks245tmb.jpg","Blocks - Harken &#187 22mm sheave","£28.16 &#187 micro fiddle with v jam and becket","");
s++; item[s]=new Array("blocks_-_harken_22mm_sheave.html","../images/harkenblocks228tmb.jpg","Blocks - Harken &#187 22mm sheave","£31.60 &#187 triple micro block","");
s++; item[s]=new Array("blocks_-_harken_22mm_sheave.html","../images/harkenblocks229tmb.jpg","Blocks - Harken &#187 22mm sheave","£32.39 &#187 triple micro block w/becket","");
s++; item[s]=new Array("blocks_-_harken_29mm_sheave.html","../images/harkenblocks348tmb.jpg","Blocks - Harken &#187 29mm sheave","£10.44 &#187 29mm single fixed carbo block","");
s++; item[s]=new Array("blocks_-_harken_29mm_sheave.html","../images/harkenblocks350tmb.jpg","Blocks - Harken &#187 29mm sheave","£10.39 &#187 29mm carbo cheeck block","");
s++; item[s]=new Array("blocks_-_harken_29mm_sheave.html","../images/harkenblocks092tmb.jpg","Blocks - Harken &#187 29mm sheave","£13.64 &#187 bullet cheek block","");
s++; item[s]=new Array("blocks_-_harken_29mm_sheave.html","../images/harkenblocks352tmb.jpg","Blocks - Harken &#187 29mm sheave","£14.12 &#187 29mm 90 degree fixed head carbo block","");
s++; item[s]=new Array("blocks_-_harken_29mm_sheave.html","../images/harkenblocks349tmb.jpg","Blocks - Harken &#187 29mm sheave","£16.30 &#187 29mm single fixed standup carbo block","");
s++; item[s]=new Array("blocks_-_harken_29mm_sheave.html","../images/harkenblocks351tmb.jpg","Blocks - Harken &#187 29mm sheave","£16.70 &#187 29mm carbo ti-lite block","");
s++; item[s]=new Array("blocks_-_harken_29mm_sheave.html","../images/harkenblocks340tmb.jpg","Blocks - Harken &#187 29mm sheave","£18.23 &#187 29mm single swivel carbo block","");
s++; item[s]=new Array("blocks_-_harken_29mm_sheave.html","../images/harkenblocks341tmb.jpg","Blocks - Harken &#187 29mm sheave","£20.44 &#187 29mm single swivel carbo block w/becket","");
s++; item[s]=new Array("blocks_-_harken_29mm_sheave.html","../images/harkenblocks353tmb.jpg","Blocks - Harken &#187 29mm sheave","£20.89 &#187 29mm carbo traveller block","");
s++; item[s]=new Array("blocks_-_harken_29mm_sheave.html","../images/harkenblocks371tmb.jpg","Blocks - Harken &#187 29mm sheave","£22.30 &#187 29mm carbo clew block assembly","");
s++; item[s]=new Array("blocks_-_harken_29mm_sheave.html","../images/harkenblocks381tmb.jpg","Blocks - Harken &#187 29mm sheave","£26.89 &#187 29mm carbo double fixed block","");
s++; item[s]=new Array("blocks_-_harken_29mm_sheave.html","../images/harkenblocks342tmb.jpg","Blocks - Harken &#187 29mm sheave","£32.14 &#187 29mm double swivel carbo block","");
s++; item[s]=new Array("blocks_-_harken_29mm_sheave.html","../images/harkenblocks343tmb.jpg","Blocks - Harken &#187 29mm sheave","£34.86 &#187 29mm double swivel carbo block w/becket","");
s++; item[s]=new Array("blocks_-_harken_29mm_sheave.html","../images/harkenblocks344tmb.jpg","Blocks - Harken &#187 29mm sheave","£42.18 &#187 29mm triple swivel carbo swivel block","");
s++; item[s]=new Array("blocks_-_harken_29mm_sheave.html","../images/harkenblocks345tmb.jpg","Blocks - Harken &#187 29mm sheave","£44.90 &#187 29mm triple swivel carbo block w/becket","");
s++; item[s]=new Array("blocks_-_harken_40mm_sheave.html","../images/harken2659tmb.jpg","Blocks - Harken &#187 40mm sheave","£25.68 &#187 40mm  90 degree fixed head carbo block","");
s++; item[s]=new Array("blocks_-_harken_40mm_sheave.html","../images/harken2652tmb.jpg","Blocks - Harken &#187 40mm sheave","£25.28 &#187 40mm  stand up fixed head carbo block","");
s++; item[s]=new Array("blocks_-_harken_40mm_sheave.html","../images/harken2658tmb.jpg","Blocks - Harken &#187 40mm sheave","£87.18 &#187 40mm  fiddler 423 carbo cam with becket","");
s++; item[s]=new Array("blocks_-_harken_40mm_sheave.html","../images/harken2655tmb.jpg","Blocks - Harken &#187 40mm sheave","£32.24 &#187 40mm  fiddle carbo block","");
s++; item[s]=new Array("blocks_-_harken_40mm_sheave.html","../images/harkenblocks2650tmb.jpg","Blocks - Harken &#187 40mm sheave","£18.82 &#187 40mm fixed carbo block","");
s++; item[s]=new Array("blocks_-_harken_40mm_sheave.html","../images/harkenblocks2651tmb.jpg","Blocks - Harken &#187 40mm sheave","£25.84 &#187 40mm carbo ti-lite block","");
s++; item[s]=new Array("blocks_-_harken_40mm_sheave.html","../images/harkenblocks2652tmb.jpg","Blocks - Harken &#187 40mm sheave","£25.28 &#187 40mm carbo block with spring and eyestrap assembled","");
s++; item[s]=new Array("blocks_-_harken_40mm_sheave.html","../images/harkenblocks2659tmb.jpg","Blocks - Harken &#187 40mm sheave","£25.68 &#187 40mm 90 degree fixed head carbo block","");
s++; item[s]=new Array("blocks_-_harken_40mm_sheave.html","../images/harkenblocks2649tmb.jpg","Blocks - Harken &#187 40mm sheave","£29.87 &#187 40mm carbo traveler block","");
s++; item[s]=new Array("blocks_-_harken_40mm_sheave.html","../images/harkenblocks2655tmb.jpg","Blocks - Harken &#187 40mm sheave","£32.24 &#187 40mm carbo fiddle","");
s++; item[s]=new Array("blocks_-_harken_40mm_sheave.html","../images/harkenblocks2608tmb.jpg","Blocks - Harken &#187 40mm sheave","£45.66 &#187 40mm carbo ratchet block","");
s++; item[s]=new Array("blocks_-_harken_40mm_sheave.html","../images/harkenblocks2609tmb.jpg","Blocks - Harken &#187 40mm sheave","£48.94 &#187 40mm carbo ratchet block w/becket","");
s++; item[s]=new Array("blocks_-_harken_40mm_sheave.html","../images/harkenblocks2658tmb.jpg","Blocks - Harken &#187 40mm sheave","£87.18 &#187 40mm carbo fiddle with cam cleat and becket","");
s++; item[s]=new Array("blocks_-_harken_57mm_sheave.html","../images/harkenblocks2135tmb.jpg","Blocks - Harken &#187 57mm sheave","£53.33 &#187 57mm carbo ratchet block","");
s++; item[s]=new Array("blocks_-_harken_57mm_sheave.html","../images/harkenblocks043tmb.jpg","Blocks - Harken &#187 57mm sheave","£59.37 &#187 2.25 hexarachet block port","");
s++; item[s]=new Array("blocks_-_harken_57mm_sheave.html","../images/harkenblocks2625tmb.jpg","Blocks - Harken &#187 57mm sheave","£75.13 &#187 57mm carbo ratchamatic","");
s++; item[s]=new Array("blocks_-_harken_57mm_sheave.html","../images/harkenblocks2626tmb.jpg","Blocks - Harken &#187 57mm sheave","£81.79 &#187 57mm carbo ratchamatic w/becket","");
s++; item[s]=new Array("blocks_-_harken_57mm_sheave.html","../images/harkenblocks188tmb.jpg","Blocks - Harken &#187 57mm sheave","£135.73 &#187 2.25 little hexaratchet with adj cam cleat and becket","");
s++; item[s]=new Array("blocks_-_harken_wire_high_load.html","../images/harkenblocks300tmb.jpg","Blocks - Harken &#187 wire high load","£26.23 &#187 1.00 single wire block","");
s++; item[s]=new Array("blocks_-_harken_wire_high_load.html","../images/harken312tmb.jpg","Blocks - Harken &#187 wire high load","£30.50 &#187 1.00 single with becket wire block","");
s++; item[s]=new Array("blocks_-_harken_wire_high_load.html","../images/harken466tmb.jpg","Blocks - Harken &#187 wire high load","£28.74 &#187 1.00 single forkhead with becket wire block.Used by laser 1 sailors.","");
s++; item[s]=new Array("blocks_-_holt_16mm_sheave.html","../images/holtblockha4078tmb.jpg","Blocks - Holt &#187 16mm sheave","£3.99 &#187 mini block","");
s++; item[s]=new Array("blocks_-_holt_16mm_sheave.html","../images/holtblockha4081tmb.jpg","Blocks - Holt &#187 16mm sheave","£5.99 &#187 double micro block","");
s++; item[s]=new Array("blocks_-_holt_16mm_sheave.html","../images/holtblockha4401tmb.jpg","Blocks - Holt &#187 16mm sheave","£9.12 &#187 15mm twin shv dk ld b sh","");
s++; item[s]=new Array("blocks_-_holt_16mm_sheave.html","../images/holtblockha4568tmb.jpg","Blocks - Holt &#187 16mm sheave","£13.25 &#187 micro ss ball block","");
s++; item[s]=new Array("blocks_-_holt_16mm_sheave.html","../images/holtblockha4068tmb.jpg","Blocks - Holt &#187 16mm sheave","£16.78 &#187 opti hook in sprit block","");
s++; item[s]=new Array("blocks_-_holt_16mm_sheave.html","../images/holtblockha4569tmb.jpg","Blocks - Holt &#187 16mm sheave","£27.11 &#187 micro ss bb block double","");
s++; item[s]=new Array("blocks_-_holt_16mm_sheave.html","../images/holtblockha4669tmb.jpg","Blocks - Holt &#187 16mm sheave","£28.99 &#187 micro ss bb dbl bkt","");
s++; item[s]=new Array("blocks_-_holt_16mm_sheave.html","../images/holtblockha4570tmb.jpg","Blocks - Holt &#187 16mm sheave","£40.25 &#187 micro ss bb triple","");
s++; item[s]=new Array("blocks_-_holt_16mm_sheave.html","../images/holtblockha4670tmb.jpg","Blocks - Holt &#187 16mm sheave","£41.99 &#187 micro ss bb triple and becket","");
s++; item[s]=new Array("blocks_-_holt_20mm_sheave.html","../images/holtblockha2021tmb.jpg","Blocks - Holt &#187 20mm sheave","£7.06 &#187 20mm multi function dyn block","");
s++; item[s]=new Array("blocks_-_holt_20mm_sheave.html","../images/holtblockha2020tmb.jpg","Blocks - Holt &#187 20mm sheave","£7.66 &#187 20mm dynamic ball block","");
s++; item[s]=new Array("blocks_-_holt_20mm_sheave.html","../images/holtblockha4450ptmb.jpg","Blocks - Holt &#187 20mm sheave","£9.50 &#187 20mm double with shackle","");
s++; item[s]=new Array("blocks_-_holt_20mm_sheave.html","../images/holtblockhaha2021hktmb.jpg","Blocks - Holt &#187 20mm sheave","£10.55 &#187 20mm dynamic hook block","");
s++; item[s]=new Array("blocks_-_holt_20mm_sheave.html","../images/holtblockha4710tmb.jpg","Blocks - Holt &#187 20mm sheave","£10.99 &#187 ss bb stand up block 20 by 6","");
s++; item[s]=new Array("blocks_-_holt_20mm_sheave.html","../images/holtblockha2021ftmb.jpg","Blocks - Holt &#187 20mm sheave","£11.25 &#187 20mm dynamic fork block","");
s++; item[s]=new Array("blocks_-_holt_20mm_sheave.html","../images/holtblockha4502tmb.jpg","Blocks - Holt &#187 20mm sheave","£13.25 &#187 20mm upstand block","");
s++; item[s]=new Array("blocks_-_holt_20mm_sheave.html","../images/holtblockha2030lztmb.jpg","Blocks - Holt &#187 20mm sheave","£13.55 &#187 20mm dynamic block on saddle","");
s++; item[s]=new Array("blocks_-_holt_20mm_sheave.html","../images/holtblockha2021sctmb.jpg","Blocks - Holt &#187 20mm sheave","£15.99 &#187 20mm dynamic bblock and swivel","");
s++; item[s]=new Array("blocks_-_holt_20mm_sheave.html","../images/holtblockha2022tmb.jpg","Blocks - Holt &#187 20mm sheave","£17.86 &#187 20mm dynamic double block","");
s++; item[s]=new Array("blocks_-_holt_20mm_sheave.html","../images/holtblockha2023tmb.jpg","Blocks - Holt &#187 20mm sheave","£18.79 &#187 20mm dynamic double becket block","");
s++; item[s]=new Array("blocks_-_holt_20mm_sheave.html","../images/holtblockha4968tmb.jpg","Blocks - Holt &#187 20mm sheave","£20.99 &#187 micro ball turning blk","");
s++; item[s]=new Array("blocks_-_holt_20mm_sheave.html","../images/holtblockha2024tmb.jpg","Blocks - Holt &#187 20mm sheave","£25.49 &#187 20mm dynamic triple block","");
s++; item[s]=new Array("blocks_-_holt_20mm_sheave.html","../images/holtblockha4451tmb.jpg","Blocks - Holt &#187 20mm sheave","£32.55 &#187 20mm thru deck block","");
s++; item[s]=new Array("blocks_-_holt_25mm_sheave.html","../images/holtblockha93tmb.jpg","Blocks - Holt &#187 25mm sheave","£7.99 &#187 block pulley with eye becket with key this comes with key not shown in photograph","");
s++; item[s]=new Array("blocks_-_holt_25mm_sheave.html","../images/holtblockha93tmb.jpg","Blocks - Holt &#187 25mm sheave","£9.99 &#187 block pulley with eye becket","");
s++; item[s]=new Array("blocks_-_holt_25mm_sheave.html","../images/holtblockha165tmb.jpg","Blocks - Holt &#187 25mm sheave","£12.55 &#187 jamming block","");
s++; item[s]=new Array("blocks_-_holt_25mm_sheave.html","../images/holtblockha165atmb.jpg","Blocks - Holt &#187 25mm sheave","£13.99 &#187 jamming block ps with straight key","");
s++; item[s]=new Array("blocks_-_holt_25mm_sheave.html","../images/holtblockha165atmb.jpg","Blocks - Holt &#187 25mm sheave","£14.25 &#187 jamming block and key curved","");
s++; item[s]=new Array("blocks_-_holt_25mm_sheave.html","../images/holtblockha4379tmb.jpg","Blocks - Holt &#187 25mm sheave","£15.35 &#187 ht mini ss ball blk 28 by 6mm","");
s++; item[s]=new Array("blocks_-_holt_25mm_sheave.html","../images/holtblockha4393tmb.jpg","Blocks - Holt &#187 25mm sheave","£17.50 &#187 ht mini ss blk and bkt 25 by 8mm","");
s++; item[s]=new Array("blocks_-_holt_25mm_sheave.html","../images/holtblockha4279tmb.jpg","Blocks - Holt &#187 25mm sheave","£19.99 &#187 25mm by 8mm ss ball block","");
s++; item[s]=new Array("blocks_-_holt_25mm_sheave.html","../images/holtblockha4479tmb.jpg","Blocks - Holt &#187 25mm sheave","£19.99 &#187 ht mid ss blk and shackle 25 by 6mm","");
s++; item[s]=new Array("blocks_-_holt_25mm_sheave.html","../images/holtblockha4679tmb.jpg","Blocks - Holt &#187 25mm sheave","£32.50 &#187 ht mini ss blk dbl 25 by 6mm","");
s++; item[s]=new Array("blocks_-_holt_27_to_30mm_sheave.html","../images/holtblockha178tmb.jpg","Blocks - Holt &#187 27 to 30mm sheave","£3.99 &#187 nylon pulley block rope","");
s++; item[s]=new Array("blocks_-_holt_27_to_30mm_sheave.html","../images/holtblockha178-74tmb.jpg","Blocks - Holt &#187 27 to 30mm sheave","£7.99 &#187 bullet block compleat with ha 74","");
s++; item[s]=new Array("blocks_-_holt_27_to_30mm_sheave.html","../images/holtblockha2031tmb.jpg","Blocks - Holt &#187 27 to 30mm sheave","£8.50 &#187 30mm dyn multi-function block","");
s++; item[s]=new Array("blocks_-_holt_27_to_30mm_sheave.html","../images/holtblockha2030tmb.jpg","Blocks - Holt &#187 27 to 30mm sheave","£8.99 &#187 30mm dynamic block","");
s++; item[s]=new Array("blocks_-_holt_27_to_30mm_sheave.html","../images/holtblockha2036tmb.jpg","Blocks - Holt &#187 27 to 30mm sheave","£12.99 &#187 30mm dynamic cheek block","");
s++; item[s]=new Array("blocks_-_holt_27_to_30mm_sheave.html","../images/holtblockha2030lztmb.jpg","Blocks - Holt &#187 27 to 30mm sheave","£13.50 &#187 30mm dynamic block on saddle","");
s++; item[s]=new Array("blocks_-_holt_27_to_30mm_sheave.html","../images/holtblockha2031ftmb.jpg","Blocks - Holt &#187 27 to 30mm sheave","£13.50 &#187 30mm dynamic block with fork","");
s++; item[s]=new Array("blocks_-_holt_27_to_30mm_sheave.html","../images/holtblockha4701tmb.jpg","Blocks - Holt &#187 27 to 30mm sheave","£15.50 &#187 27mm thru deck ball sheave","");
s++; item[s]=new Array("blocks_-_holt_27_to_30mm_sheave.html","../images/holtblockha4801tmb.jpg","Blocks - Holt &#187 27 to 30mm sheave","£15.50 &#187 27mm ball blk side fstn","");
s++; item[s]=new Array("blocks_-_holt_27_to_30mm_sheave.html","../images/holtblockha2031sctmb.jpg","Blocks - Holt &#187 27 to 30mm sheave","£17.50 &#187 30mm dyn blk with swivel fork","");
s++; item[s]=new Array("blocks_-_holt_27_to_30mm_sheave.html","../images/holtblockha4901tmb.jpg","Blocks - Holt &#187 27 to 30mm sheave","£18.55 &#187 27mm ball sheave dbl dck bx","");
s++; item[s]=new Array("blocks_-_holt_27_to_30mm_sheave.html","../images/holtblockha4101tmb.jpg","Blocks - Holt &#187 27 to 30mm sheave","£20.00 &#187 27mm upstand block","");
s++; item[s]=new Array("blocks_-_holt_27_to_30mm_sheave.html","../images/holtblockha4978tmb.jpg","Blocks - Holt &#187 27 to 30mm sheave","£20.15 &#187 ball race flip flop block","");
s++; item[s]=new Array("blocks_-_holt_27_to_30mm_sheave.html","../images/holtblockha2032tmb.jpg","Blocks - Holt &#187 27 to 30mm sheave","£20.50 &#187 30mm dynamic double block","");
s++; item[s]=new Array("blocks_-_holt_27_to_30mm_sheave.html","../images/holtblockha2033tmb.jpg","Blocks - Holt &#187 27 to 30mm sheave","£21.50 &#187 30mm dynamic double block and becket","");
s++; item[s]=new Array("blocks_-_holt_27_to_30mm_sheave.html","../images/holtblockha4280dtmb.jpeg","Blocks - Holt &#187 27 to 30mm sheave","£26.00 &#187 blocks times 2 on ss ring","");
s++; item[s]=new Array("blocks_-_holt_27_to_30mm_sheave.html","../images/holtblockha2034tmb.jpg","Blocks - Holt &#187 27 to 30mm sheave","£29.99 &#187 30mm dynamic tripple block","");
s++; item[s]=new Array("blocks_-_holt_27_to_30mm_sheave.html","../images/holtblockha2035tmb.jpg","Blocks - Holt &#187 27 to 30mm sheave","£37.50 &#187 30mm dynamic tripple block and becket","");
s++; item[s]=new Array("blocks_-_holt_27_to_30mm_sheave.html","../images/holtblockha4978-77tmb.jpg","Blocks - Holt &#187 27 to 30mm sheave","£47.66 &#187 turning block ss with ha 77","");
s++; item[s]=new Array("blocks_-_holt_38_to_40mm_sheave.html","../images/holtblockha278tmb.jpg","Blocks - Holt &#187 38 to 40mm sheave","£6.50 &#187 bullet block","");
s++; item[s]=new Array("blocks_-_holt_38_to_40mm_sheave.html","../images/holtblockha278-74tmb.jpg","Blocks - Holt &#187 38 to 40mm sheave","£7.99 &#187 bullet block compleat with ha 74","");
s++; item[s]=new Array("blocks_-_holt_38_to_40mm_sheave.html","../images/holtblockha378tmb.jpg","Blocks - Holt &#187 38 to 40mm sheave","£7.99 &#187 pulley single eye and bkt","");
s++; item[s]=new Array("blocks_-_holt_38_to_40mm_sheave.html","../images/holtblockha3280ptmb.jpg","Blocks - Holt &#187 38 to 40mm sheave","£12.99 &#187 38mm b bullet block","");
s++; item[s]=new Array("blocks_-_holt_38_to_40mm_sheave.html","../images/holtblockha4196tmb.jpg","Blocks - Holt &#187 38 to 40mm sheave","£27.99 &#187 ht ss ball block 38 by 6mm","");
s++; item[s]=new Array("blocks_-_holt_38_to_40mm_sheave.html","../images/holtblockha4396tmb.jpg","Blocks - Holt &#187 38 to 40mm sheave","£30.99 &#187 ht ball ss block and becket 38 by 8mm","");
s++; item[s]=new Array("blocks_-_holt_38_to_40mm_sheave.html","../images/holtblockha4296tmb.jpg","Blocks - Holt &#187 38 to 40mm sheave","£31.99 &#187 ht ball ss block and shackle 38 by 8mm","");
s++; item[s]=new Array("blocks_-_holt_38_to_40mm_sheave.html","../images/holtblockha4596tmb.jpg","Blocks - Holt &#187 38 to 40mm sheave","£59.99 &#187 ht ball ss blk dbl and bkt","");
s++; item[s]=new Array("blocks_-_ronstan_20_mm_sheave.html","../images/ronstanblocksrf20101tmb.jpg","Blocks - Ronstan &#187 20 mm sheave","£9.23 &#187 bb block single loop top","");
s++; item[s]=new Array("blocks_-_ronstan_20_mm_sheave.html","../images/ronstanblocksrf20151tmb.jpg","Blocks - Ronstan &#187 20 mm sheave","£11.06 &#187 bb block ,single ,cheek","");
s++; item[s]=new Array("blocks_-_ronstan_20_mm_sheave.html","../images/ronstanblocksrf20111tmb.jpg","Blocks - Ronstan &#187 20 mm sheave","£12.13 &#187 bb block single loop top ,becket","");
s++; item[s]=new Array("blocks_-_ronstan_20_mm_sheave.html","../images/ronstanblocksrf20184tmb.jpg","Blocks - Ronstan &#187 20 mm sheave","£12.76 &#187 bb block single loop mount","");
s++; item[s]=new Array("blocks_-_ronstan_20_mm_sheave.html","../images/ronstanblocksrf20151atmb.jpg","Blocks - Ronstan &#187 20 mm sheave","£14.77 &#187 bb block ,single ,cheek rivet mount","");
s++; item[s]=new Array("blocks_-_ronstan_20_mm_sheave.html","../images/ronstanblocksrf20171tmb.jpg","Blocks - Ronstan &#187 20 mm sheave","£14.11 &#187 bb block upright lead","");
s++; item[s]=new Array("blocks_-_ronstan_20_mm_sheave.html","../images/ronstanblocksrf20141tmb.jpg","Blocks - Ronstan &#187 20 mm sheave","£14.89 &#187 bb block stand-up loop top","");
s++; item[s]=new Array("blocks_-_ronstan_20_mm_sheave.html","../images/ronstanblocksrf20100tmb.jpg","Blocks - Ronstan &#187 20 mm sheave","£15.54 &#187 bb block single","");
s++; item[s]=new Array("blocks_-_ronstan_20_mm_sheave.html","../images/ronstanblocksrf24101tmb.jpg","Blocks - Ronstan &#187 20 mm sheave","£20.63 &#187 bb block single loop top","");
s++; item[s]=new Array("blocks_-_ronstan_20_mm_sheave.html","../images/ronstanblocksrf20284tmb.jpg","Blocks - Ronstan &#187 20 mm sheave","£19.45 &#187 bb blocks loop top linked","");
s++; item[s]=new Array("blocks_-_ronstan_20_mm_sheave.html","../images/ronstanblocksrf20711tmb.jpg","Blocks - Ronstan &#187 20 mm sheave","£19.16 &#187 bb block single exit cover plate","");
s++; item[s]=new Array("blocks_-_ronstan_20_mm_sheave.html","../images/ronstanblocksrf20281tmb.jpg","Blocks - Ronstan &#187 20 mm sheave","£22.26 &#187 bb block double in line","");
s++; item[s]=new Array("blocks_-_ronstan_20_mm_sheave.html","../images/ronstanblocksrf20711atmb.jpg","Blocks - Ronstan &#187 20 mm sheave","£20.90 &#187 bb block single exit side tabs","");
s++; item[s]=new Array("blocks_-_ronstan_20_mm_sheave.html","../images/ronstanblocksrf24108tmb.jpg","Blocks - Ronstan &#187 20 mm sheave","£18.99 &#187 bb block single loop top clevis pin top","");
s++; item[s]=new Array("blocks_-_ronstan_20_mm_sheave.html","../images/ronstanblocksrf20202tmb.jpg","Blocks - Ronstan &#187 20 mm sheave","£23.41 &#187 bb block double","");
s++; item[s]=new Array("blocks_-_ronstan_20_mm_sheave.html","../images/ronstanblocksrf24118tmb.jpg","Blocks - Ronstan &#187 20 mm sheave","£21.50 &#187 bb block single loop top becket clevis pin top","");
s++; item[s]=new Array("blocks_-_ronstan_20_mm_sheave.html","../images/ronstanblocksrf20212tmb.jpg","Blocks - Ronstan &#187 20 mm sheave","£25.79 &#187 bb block double becket","");
s++; item[s]=new Array("blocks_-_ronstan_20_mm_sheave.html","../images/ronstanblocksrf20302tmb.jpg","Blocks - Ronstan &#187 20 mm sheave","£32.41 &#187 bb block triple","");
s++; item[s]=new Array("blocks_-_ronstan_20_mm_sheave.html","../images/ronstanrf20332tmb.jpg","Blocks - Ronstan &#187 20 mm sheave","£59.88 &#187 bb block triple with cam and becket","");
s++; item[s]=new Array("blocks_-_ronstan_30_mm_sheave.html","../images/ronstanrf35100tmb.jpg","Blocks - Ronstan &#187 30 mm sheave","£17.38 &#187 bb orbit block single and becket","");
s++; item[s]=new Array("blocks_-_ronstan_30_mm_sheave.html","../images/ronstanrf35100atmb.jpg","Blocks - Ronstan &#187 30 mm sheave","£22.08 &#187 rf35100a","");
s++; item[s]=new Array("blocks_-_ronstan_30_mm_sheave.html","../images/ronstanrf35101tmb.jpg","Blocks - Ronstan &#187 30 mm sheave","£17.38 &#187 rf35101","");
s++; item[s]=new Array("blocks_-_ronstan_30_mm_sheave.html","../images/ronstanblocksrf30151tmb.jpg","Blocks - Ronstan &#187 30 mm sheave","£12.99 &#187 bb block single cheek","");
s++; item[s]=new Array("blocks_-_ronstan_30_mm_sheave.html","../images/ronstanblocksrf30151atmb.jpg","Blocks - Ronstan &#187 30 mm sheave","£12.99 &#187 bb block single cheek rivet mount","");
s++; item[s]=new Array("blocks_-_ronstan_30_mm_sheave.html","../images/ronstanblocksrf30171tmb.jpg","Blocks - Ronstan &#187 30 mm sheave","£14.44 &#187 bb block upright lead","");
s++; item[s]=new Array("blocks_-_ronstan_30_mm_sheave.html","../images/ronstanblocksrf30711tmb.jpg","Blocks - Ronstan &#187 30 mm sheave","£15.95 &#187 bb block exit with cover plate","");
s++; item[s]=new Array("blocks_-_ronstan_30_mm_sheave.html","../images/ronstanblocksrf34101tmb.jpg","Blocks - Ronstan &#187 30 mm sheave","£14.99 &#187 bb block single loop top","");
s++; item[s]=new Array("blocks_-_ronstan_30_mm_sheave.html","../images/ronstanblocksrf30110tmb.jpg","Blocks - Ronstan &#187 30 mm sheave","£15.99 &#187 bb block single becket","");
s++; item[s]=new Array("blocks_-_ronstan_30_mm_sheave.html","../images/ronstanblocksrf30140tmb.jpg","Blocks - Ronstan &#187 30 mm sheave","£17.50 &#187 bb block stand up swivel head","");
s++; item[s]=new Array("blocks_-_ronstan_30_mm_sheave.html","../images/ronstanblocksrf30284tmb.jpg","Blocks - Ronstan &#187 30 mm sheave","£17.50 &#187 bb block loop top linked","");
s++; item[s]=new Array("blocks_-_ronstan_30_mm_sheave.html","../images/ronstanblocksrf30285tmb.jpg","Blocks - Ronstan &#187 30 mm sheave","£17.50 &#187 30 mm bb block linked with series 20 block","");
s++; item[s]=new Array("blocks_-_ronstan_30_mm_sheave.html","../images/ronstanblocksrf30286tmb.jpg","Blocks - Ronstan &#187 30 mm sheave","£18..99 &#187 bb blocks loop top clew ring linked","");
s++; item[s]=new Array("blocks_-_ronstan_30_mm_sheave.html","../images/ronstanblocksrf30721tmb.jpg","Blocks - Ronstan &#187 30 mm sheave","£18.99 &#187 bb block double exit with cover plate","");
s++; item[s]=new Array("blocks_-_ronstan_30_mm_sheave.html","../images/ronstanblocksrf30202tmb.jpg","Blocks - Ronstan &#187 30 mm sheave","£22.99 &#187 bb block double","");
s++; item[s]=new Array("blocks_-_ronstan_30_mm_sheave.html","../images/ronstanblocksrf30212tmb.jpg","Blocks - Ronstan &#187 30 mm sheave","£26.50 &#187 block double becket","");
s++; item[s]=new Array("blocks_-_ronstan_30_mm_sheave.html","../images/ronstanblocksrf34108tmb.jpg","Blocks - Ronstan &#187 30 mm sheave","£35.46 &#187 bb block single loop top clevis pin top","");
s++; item[s]=new Array("blocks_-_ronstan_30_mm_sheave.html","../images/ronstanblocksrf34118tmb.jpg","Blocks - Ronstan &#187 30 mm sheave","£28.99 &#187 bb block single loop top becket clevis pin top","");
s++; item[s]=new Array("blocks_-_ronstan_30_mm_sheave.html","../images/ronstanblocksrf30312tmb.jpg","Blocks - Ronstan &#187 30 mm sheave","£31.99 &#187 bb block triple ","");
s++; item[s]=new Array("blocks_-_ronstan_30_mm_sheave.html","../images/ronstanblocksrf30312tmb.jpg","Blocks - Ronstan &#187 30 mm sheave","£31.99 &#187 bb block triple becket","");
s++; item[s]=new Array("blocks_-_ronstan_30_mm_sheave.html","../images/ronstanblocksrf30332tmb.jpg","Blocks - Ronstan &#187 30 mm sheave","£58.50 &#187 bb block triple cleat becket","");
s++; item[s]=new Array("blocks_-_ronstan_40_mm_sheave.html","../images/ronstanrf46101tmb.jpg","Blocks - Ronstan &#187 40 mm sheave","£46.18 &#187 orbit ratchet block","");
s++; item[s]=new Array("blocks_-_ronstan_40_mm_sheave.html","../images/ronstanrf44108tmb.jpg","Blocks - Ronstan &#187 40 mm sheave","£56.55 &#187 bb block single loop top narrow series","");
s++; item[s]=new Array("blocks_-_ronstan_40_mm_sheave.html","../images/ronstanrf40520tmb.jpg","Blocks - Ronstan &#187 40 mm sheave","£59.01 &#187 bb block fiddle cleat","");
s++; item[s]=new Array("blocks_-_ronstan_40_mm_sheave.html","../images/ronstanblocksrf40101tmb.jpg","Blocks - Ronstan &#187 40 mm sheave","£18.47 &#187 bb block single loop top","");
s++; item[s]=new Array("blocks_-_ronstan_40_mm_sheave.html","../images/ronstanblocksrf40100tmb.jpg","Blocks - Ronstan &#187 40 mm sheave","£22.37 &#187 bb block single","");
s++; item[s]=new Array("blocks_-_ronstan_40_mm_sheave.html","../images/ronstanblocksrf40111tmb.jpg","Blocks - Ronstan &#187 40 mm sheave","£22.46 &#187 bb block single loop top ,becket","");
s++; item[s]=new Array("blocks_-_ronstan_40_mm_sheave.html","../images/ronstanblocksrf40140tmb.jpg","Blocks - Ronstan &#187 40 mm sheave","£28.61 &#187 bb block single stand up","");
s++; item[s]=new Array("blocks_-_ronstan_40_mm_sheave.html","../images/ronstanblocksrf42100tmb.jpg","Blocks - Ronstan &#187 40 mm sheave","£45.99 &#187 smart-ratchet single","");
s++; item[s]=new Array("blocks_-_ronstan_50_mm_sheave.html","../images/ronstanblocksrf50520tmb.jpg","Blocks - Ronstan &#187 50 mm sheave","£89.07 &#187 bb block fiddle cleat","");
s++; item[s]=new Array("blocks_-_ronstan_55_mm_sheave.html","../images/ronstanrf56111tmb.jpg","Blocks - Ronstan &#187 55 mm sheave","£64.69 &#187 series 55 rt orbit block","");
s++; item[s]=new Array("blocks_-_ronstan_55_mm_sheave.html","../images/ronstanrf56101tmb.jpg","Blocks - Ronstan &#187 55 mm sheave","£61.25 &#187 series 55 rt orbit block","");
s++; item[s]=new Array("blocks_-_ronstan_55_mm_sheave.html","../images/ronstanrf55111tmb.jpg","Blocks - Ronstan &#187 55 mm sheave","£36.95 &#187 series 55 bb orbit block","");
s++; item[s]=new Array("blocks_-_ronstan_55_mm_sheave.html","../images/ronstanrf55201tmb.jpg","Blocks - Ronstan &#187 55 mm sheave","£67.57 &#187 series 55 bb orbit block","");
s++; item[s]=new Array("blocks_-_ronstan_55_mm_sheave.html","../images/ronstanrf55151tmb.jpg","Blocks - Ronstan &#187 55 mm sheave","£32.33 &#187 series 55 bb orbit block","");
s++; item[s]=new Array("blocks_-_ronstan_55_mm_sheave.html","../images/ronstanrf55501tmb.jpg","Blocks - Ronstan &#187 55 mm sheave","£41.12 &#187 series 55 bb orbit block","");
s++; item[s]=new Array("blocks_-_ronstan_55_mm_sheave.html","../images/ronstanrf55521tmb.jpg","Blocks - Ronstan &#187 55 mm sheave","£94.50 &#187 series 55 bb orbit block","");
s++; item[s]=new Array("blocks_-_ronstan_55_mm_sheave.html","../images/ronstanrf55511tmb.jpg","Blocks - Ronstan &#187 55 mm sheave","£45.53 &#187 series 55 bb orbit block","");
s++; item[s]=new Array("blocks_-_ronstan_60_mm_sheave.html","../images/ronstanblocksrf62110tmb.jpg","Blocks - Ronstan &#187 60 mm sheave","£72.00 &#187 ratchet block single becket","");
s++; item[s]=new Array("blocks_-_ronstan_accessories.html","../images/ronstanrf50001tmb.jpg","Blocks - Ronstan &#187 Accessories","£5.77 &#187 retainer clip","");
s++; item[s]=new Array("blocks_-_ronstan_accessories.html","../images/ronstanrf50001tmb.jpg","Blocks - Ronstan &#187 Accessories","£5.77 &#187 retainer clip","");
s++; item[s]=new Array("blocks_-_ronstan_accessories.html","../images/ronstanrf50001tmb.jpg","Blocks - Ronstan &#187 Accessories","£5.77 &#187 retainer clip","");
s++; item[s]=new Array("blocks_-_ronstan_accessories.html","../images/ronstanrf2455tmb.jpg","Blocks - Ronstan &#187 Accessories","£12.01 &#187 stand up base","");
s++; item[s]=new Array("blocks_-_ronstan_accessories.html","../images/ronstanrf9004tmb.jpg","Blocks - Ronstan &#187 Accessories","£6.92 &#187 dyneema link","");
s++; item[s]=new Array("blocks_-_ronstan_accessories.html","../images/ronstanrf9004tmb.jpg","Blocks - Ronstan &#187 Accessories","£8.07 &#187 dyneema link","");
s++; item[s]=new Array("boat_-_laser_accessories.html","../images/magicmarinelaser1mastbag08tmb.jpg","Boat - Laser &#187 Accessories","£34.99 &#187 Magic Marine Laser spar bag 09","Will fit top section,lower mast and boom. 3,6m by 36cm.Has 2 compartments measuring 20 and 16cm.");
s++; item[s]=new Array("boat_-_laser_accessories.html","../images/magicmarinelaser1sailbag08tmb.jpg","Boat - Laser &#187 Accessories","£34.99 &#187 Magic Marine Laser rolled sail bag 09","");
s++; item[s]=new Array("boat_-_laser_accessories.html","../images/magicmarinelaser1rolledsailbagtmb.jpg","Boat - Laser &#187 Accessories","£27.99 &#187 Magic Marine Laser rolled sail bag","2.7m by 40cm");
s++; item[s]=new Array("boat_-_laser_accessories.html","../images/magicmarinelaserfoilcombibagtmb.jpg","Boat - Laser &#187 Accessories","£39.99 &#187 Magic Marine Laser Foil and Extension Bag","");
s++; item[s]=new Array("boat_-_laser_accessories.html","../images/magicmarinelaser1foilbag08tmb.jpg","Boat - Laser &#187 Accessories","£49.99 &#187 Magic Marine Laser Foil and Extension Bag 09","");
s++; item[s]=new Array("boat_-_laser_accessories.html","../images/magicmarinelaser1deckcovertmb.jpg","Boat - Laser &#187 Accessories","£89.99 &#187 Laser Magic Marine top cover 09","");
s++; item[s]=new Array("boat_-_laser_accessories.html","../images/magicmarine08laser1bottomcovertmb.jpg","Boat - Laser &#187 Accessories","£104.99 &#187 Laser Magic Marine bottom cover 09","");
s++; item[s]=new Array("boat_-_laser_accessories.html","../images/mmlaser1bottomcover07tmb.jpg","Boat - Laser &#187 Accessories","£89.99 &#187 Laser Magic Marine bottom cover","");
s++; item[s]=new Array("boat_-_laser_accessories.html","../images/trailerwestmerseac25tla1tmb.jpg","Boat - Laser &#187 Accessories","£226.00 &#187 C25 TLA Laser Gunwhale Hung Laser 1 launch trolley","");
s++; item[s]=new Array("boat_-_laser_foils_tillers_etc.html","../images/laser1clevisringforrudder1365atmb.jpg","Boat - Laser &#187 Foils tillers etc","£0.99 &#187 Laser large clevis ring","Safety ring to retain rudder onto pintles.");
s++; item[s]=new Array("boat_-_laser_foils_tillers_etc.html","../images/laser1rudderretainingpin3224tmb.jpg","Boat - Laser &#187 Foils tillers etc","£1.60 &#187 Laser Tiller Retaining Pin","");
s++; item[s]=new Array("boat_-_laser_foils_tillers_etc.html","../images/laserfoilsetc3213xdtmb.jpeg","Boat - Laser &#187 Foils tillers etc","£3.95 &#187 Laser XD Mega Bolt","");
s++; item[s]=new Array("boat_-_laser_foils_tillers_etc.html","../images/laserfoilsetc1201tmb.jpeg","Boat - Laser &#187 Foils tillers etc","£4.95 &#187 Laser Daggerboard Stopper","");
s++; item[s]=new Array("boat_-_laser_foils_tillers_etc.html","../images/optipartslaserstandardtillertmb.jpeg","Boat - Laser &#187 Foils tillers etc","£26.99 &#187 Laser Tiller","");
s++; item[s]=new Array("boat_-_laser_foils_tillers_etc.html","../images/laserfatsocarbontillerextension1640tmb.jpg","Boat - Laser &#187 Foils tillers etc","£70.00 &#187 Laser Fatso Carbon Tiller Extension","");
s++; item[s]=new Array("boat_-_laser_foils_tillers_etc.html","../images/lasergorrilatillerandextension1619tmb.jpg","Boat - Laser &#187 Foils tillers etc","£89.95 &#187 Laser Gorilla Tiller and Extension","");
s++; item[s]=new Array("boat_-_laser_foils_tillers_etc.html","../images/laser1rudderstock1212tmb.jpg","Boat - Laser &#187 Foils tillers etc","£103.95 &#187 Laser Rudder stock","");
s++; item[s]=new Array("boat_-_laser_foils_tillers_etc.html","../images/laser1xdcarbontillertmb.jpg","Boat - Laser &#187 Foils tillers etc","£150.00 &#187 Laser XD carbon Tiller","");
s++; item[s]=new Array("boat_-_laser_foils_tillers_etc.html","../images/laserfoilsetc1211tmb.jpeg","Boat - Laser &#187 Foils tillers etc","£165.00 &#187 Laser Rudder Blade","");
s++; item[s]=new Array("boat_-_laser_foils_tillers_etc.html","../images/laserfoilsetc1210tmb.jpeg","Boat - Laser &#187 Foils tillers etc","£225.00 &#187 Laser Rudder Blade with Stock","");
s++; item[s]=new Array("boat_-_laser_foils_tillers_etc.html","../images/laser1daggerboard1200tmb.jpg","Boat - Laser &#187 Foils tillers etc","£245.00 &#187 Laser Dagger Board","");
s++; item[s]=new Array("boat_-_laser_hull_and_deck_fittings.html","../images/laserhullanddeckfttings1135tmb.jpeg","Boat - Laser &#187 Hull and deck fittings","£0.75 &#187 Laser Self Bailor Bungs","");
s++; item[s]=new Array("boat_-_laser_hull_and_deck_fittings.html","../images/laserhullanddeckfttings1134tmb.jpeg","Boat - Laser &#187 Hull and deck fittings","£1.50 &#187 Laser Friction Pad","");
s++; item[s]=new Array("boat_-_laser_hull_and_deck_fittings.html","../images/laserhullanddeckfttings1532tmb.jpeg","Boat - Laser &#187 Hull and deck fittings","£2.95 &#187 Laser Fairlead Wire","");
s++; item[s]=new Array("boat_-_laser_hull_and_deck_fittings.html","../images/laserhullanddeckfttings1531tmb.jpeg","Boat - Laser &#187 Hull and deck fittings","£3.75 &#187 Laser Jam Cleat Fairleads","Laser Holt Jam Cleat Pro-lead Ultra Small");
s++; item[s]=new Array("boat_-_laser_hull_and_deck_fittings.html","../images/laser1gudgeon3150tmb.jpg","Boat - Laser &#187 Hull and deck fittings","£7.95 &#187 Laser Rudder Gudgeons","");
s++; item[s]=new Array("boat_-_laser_hull_and_deck_fittings.html","../images/laser1extremefairlead1550tmb.jpg","Boat - Laser &#187 Hull and deck fittings","£9.50 &#187 Laser Jam Cleat Fairleads","");
s++; item[s]=new Array("boat_-_laser_hull_and_deck_fittings.html","../images/laserhullanddeckfttings1136tmb.jpeg","Boat - Laser &#187 Hull and deck fittings","£9.95 &#187 Laser Cockpit Brass Plugs","");
s++; item[s]=new Array("boat_-_laser_hull_and_deck_fittings.html","../images/laserhullanddeckfttings1662tmb.jpeg","Boat - Laser &#187 Hull and deck fittings","£10.50 &#187 Laser Bailer Repair Kit","");
s++; item[s]=new Array("boat_-_laser_hull_and_deck_fittings.html","../images/laserhullanddeckfttings1527tmb.jpeg","Boat - Laser &#187 Hull and deck fittings","£10.95 &#187 Laser XD Pack Block Plate","");
s++; item[s]=new Array("boat_-_laser_hull_and_deck_fittings.html","../images/laserhullanddeckfttings3140tmb.jpeg","Boat - Laser &#187 Hull and deck fittings","£15.95 &#187 Laser Plastic Strip","");
s++; item[s]=new Array("boat_-_laser_hull_and_deck_fittings.html","../images/magicmarinelaser1toestrapracestd08tmb.jpg","Boat - Laser &#187 Hull and deck fittings","£15.99 &#187 Magic Marine Toestrap","Two options 7.5cm wide or 10.5cm wide");
s++; item[s]=new Array("boat_-_laser_hull_and_deck_fittings.html","../images/laserhullanddeckfttings1526tmb.jpeg","Boat - Laser &#187 Hull and deck fittings","£16.95 &#187 Laser Deck Cleat Plate","");
s++; item[s]=new Array("boat_-_laser_hull_and_deck_fittings.html","../images/lasersparesnewzealandpaddedtoestraptmb.jpg","Boat - Laser &#187 Hull and deck fittings","£21.00 &#187 New Zealand padded toestrap","");
s++; item[s]=new Array("boat_-_laser_hull_and_deck_fittings.html","../images/laser1blockplatecomplete1529tmb.jpg","Boat - Laser &#187 Hull and deck fittings","£27.50 &#187 Laser XD Pack Block Plate Complete","");
s++; item[s]=new Array("boat_-_laser_hull_and_deck_fittings.html","../images/laserhullanddeckfttings1660tmb.jpeg","Boat - Laser &#187 Hull and deck fittings","£31.50 &#187 Laser Self Bailor","");
s++; item[s]=new Array("boat_-_laser_hull_and_deck_fittings.html","../images/laser1powerpack1514tmb.jpg","Boat - Laser &#187 Hull and deck fittings","£140.00 &#187 Laser XD Power Pack","");
s++; item[s]=new Array("boat_-_laser_sails_and_accessories.html","../images/useddinghysaillaser1std67082tmb.jpg","Boat - Laser &#187 Sails and accessories","£15.00 &#187 Laser 1 standard sail","");
s++; item[s]=new Array("boat_-_laser_sails_and_accessories.html","../images/roosterropetmb.gif","Boat - Laser &#187 Sails and accessories","£1.30 &#187 7mm rooster rope","The rope has a light high stretch inner core which leaves the outer core to be the load bearer.Due to the unique design the outer core takes the load instead of the inner core.This helps to maintain stability and prevents the rope from tangling.");
s++; item[s]=new Array("boat_-_laser_sails_and_accessories.html","../images/lasersails1462tmb.jpeg","Boat - Laser &#187 Sails and accessories","£8.50 &#187 Laser Short Batten","");
s++; item[s]=new Array("boat_-_laser_sails_and_accessories.html","../images/lasersails1462tmb.jpeg","Boat - Laser &#187 Sails and accessories","£11.50 &#187 Laser long Batten","");
s++; item[s]=new Array("boat_-_laser_sails_and_accessories.html","../images/lasersails1460tmb.jpeg","Boat - Laser &#187 Sails and accessories","£26.00 &#187 Laser Sail Batten Set","");
s++; item[s]=new Array("boat_-_laser_sails_and_accessories.html","../images/laserssailrolledradialsailtmb.jpg","Boat - Laser &#187 Sails and accessories","£390.00 &#187 Laser 4.7 Sail","Rolled sail and bag");
s++; item[s]=new Array("boat_-_laser_sails_and_accessories.html","../images/laserssailrolledradialsailtmb.jpg","Boat - Laser &#187 Sails and accessories","£420.00 &#187 Laser Radial Sail","Rolled sail and bag");
s++; item[s]=new Array("boat_-_laser_sails_and_accessories.html","../images/laserssailrolledradialsailtmb.jpg","Boat - Laser &#187 Sails and accessories","£420.00 &#187 Laser Standard Sail","Rolled sail and bag");
s++; item[s]=new Array("boat_-_laser_spars_and_fittings.html","../images/lasersparfittings3303ptmb.jpeg","Boat - Laser &#187 Spars and fittings","£5.50 &#187 Laser Back Boom Block","");
s++; item[s]=new Array("boat_-_laser_spars_and_fittings.html","../images/lasersparfittings3305ptmb.jpeg","Boat - Laser &#187 Spars and fittings","£6.50 &#187 Laser Single Block with Becket","");
s++; item[s]=new Array("boat_-_laser_spars_and_fittings.html","../images/laserspars1322tmb.jpeg","Boat - Laser &#187 Spars and fittings","£7.95 &#187 Laser radial lower Mast base","");
s++; item[s]=new Array("boat_-_laser_spars_and_fittings.html","../images/laser47lowermastplug1312tmb.jpg","Boat - Laser &#187 Spars and fittings","£8.95 &#187 Laser 4.7 lower Mast base","");
s++; item[s]=new Array("boat_-_laser_spars_and_fittings.html","../images/lasersparfittings1302tmb.jpeg","Boat - Laser &#187 Spars and fittings","£8.95 &#187 Laser Upper Mast Sleeve","");
s++; item[s]=new Array("boat_-_laser_spars_and_fittings.html","../images/lasersparfittings1305tmb.jpeg","Boat - Laser &#187 Spars and fittings","£8.95 &#187 Laser Upper Mast Base Plug","");
s++; item[s]=new Array("boat_-_laser_spars_and_fittings.html","../images/lasersparfittings1312tmb.jpeg","Boat - Laser &#187 Spars and fittings","£8.95 &#187 Laser Standard lower Mast base","");
s++; item[s]=new Array("boat_-_laser_spars_and_fittings.html","../images/lasersparfittings3307tmb.jpeg","Boat - Laser &#187 Spars and fittings","£8.95 &#187 Laser Upper Mast Top Plug","");
s++; item[s]=new Array("boat_-_laser_spars_and_fittings.html","../images/lasersparfittings3308tmb.jpeg","Boat - Laser &#187 Spars and fittings","£8.95 &#187 Laser Gooseneck Boom Plug","");
s++; item[s]=new Array("boat_-_laser_spars_and_fittings.html","../images/laser1clewstraptmb.jpg","Boat - Laser &#187 Spars and fittings","£9.99 &#187 Laser clewstrop","The ultimate clew tie down system for the Laser®. One end of the strap has the loop velcro on both sides. It then sandwiches between the hook velcro, providing so much contact area that the strap will not slip. A piece of hard material reduces friction between the webbing and the boom. Can be used with a clew hook, with or without Harken airblock, to create a quick easy and reliable clew system.");
s++; item[s]=new Array("boat_-_laser_spars_and_fittings.html","../images/laser1boomplate3302tmb.jpg","Boat - Laser &#187 Spars and fittings","£10.50 &#187 Laser Kicking Strap plate (boom)","");
s++; item[s]=new Array("boat_-_laser_spars_and_fittings.html","../images/lasersparfittings1336tmb.jpeg","Boat - Laser &#187 Spars and fittings","£10.95 &#187 Laser Kicking Strap mast","");
s++; item[s]=new Array("boat_-_laser_spars_and_fittings.html","../images/lasersparfittings1331tmb.jpeg","Boat - Laser &#187 Spars and fittings","£21.00 &#187 Laser Gooseneck","");
s++; item[s]=new Array("boat_-_laser_spars_and_fittings.html","../images/laser1harkenclewsleevetmb.jpg","Boat - Laser &#187 Spars and fittings","£34.95 &#187 Laser Harken clewstrop","Laser Spar fittings Produced by Harken, a combination of a low friction metal sleeve and ball bearing block facilitates easy outhaul adjustment and will ease more smoothly in light air Clew rigging is easier and is keeps the sail flush with the boom The sleeve comes fully assembled and mounted on a display card that includes rigging and use instructions");
s++; item[s]=new Array("boat_-_laser_spars_and_fittings.html","../images/laser1sparcarrierstmb.jpg","Boat - Laser &#187 Spars and fittings","£34.95 &#187 Laser spar carriers","");
s++; item[s]=new Array("boat_-_laser_spars_and_fittings.html","../images/lasersparesmasttopsectionsilvertmb.jpg","Boat - Laser &#187 Spars and fittings","£112.00 &#187 Laser Mast Top Section","");
s++; item[s]=new Array("boat_-_laser_spars_and_fittings.html","../images/laser1boom1360tmb.jpg","Boat - Laser &#187 Spars and fittings","£130.00 &#187 Laser Boom","");
s++; item[s]=new Array("boat_-_laser_spars_and_fittings.html","../images/lasersparfittings1535tmb.jpeg","Boat - Laser &#187 Spars and fittings","£135.00 &#187 Laser XD Vang Pack","");
s++; item[s]=new Array("boat_-_laser_spars_and_fittings.html","../images/lasersparesmastbottomsectionblacktmb.jpg","Boat - Laser &#187 Spars and fittings","£149.00 &#187 Laser Bottom Section Black","");
s++; item[s]=new Array("boat_-_laser_spars_and_fittings.html","../images/lasersparsbottomsection47tmb.jpg","Boat - Laser &#187 Spars and fittings","£160.00 &#187 Laser 4.7 bottom section","");
s++; item[s]=new Array("boat_-_laser_spars_and_fittings.html","../images/laser1radiallowermast1320tmb.jpg","Boat - Laser &#187 Spars and fittings","£160.00 &#187 Laser Radial Lower Mast","");
s++; item[s]=new Array("boat_-_laser_spars_and_fittings.html","../images/lasersparesmastbottomsectionsilvertmb.jpg","Boat - Laser &#187 Spars and fittings","£180.00 &#187 Laser Standard Bottom Section Silver","");
s++; item[s]=new Array("boat_-_laser_4000_foils_tillers_etc.html","../images/laser4000rudderbladetmb.jpg","Boat - Laser 4000 &#187 Foils tillers etc","£149.00 &#187 Rudder blade - Special offer","");
s++; item[s]=new Array("boat_-_optimist_accessories.html","../images/optipartslaunchtrolleytmb.gif","Boat - Optimist &#187 Accessories","£148.99 &#187 Optiparts Aluminum trolley with small or large pneumatic wheels","Optiparts launch trolley Aluminum trolley with small or large pneumatic wheels. Now with stainless steel heel protector and BOW WOW !! A new unique system to lock the bow to the trolley with one quick and simple movement. The hull will not slide off the slippery wet trolley anymore. The BOW WOW prevents damage to the stern. Also available as a replacement kit to fit older Optiparts trolleys. Quick release push buttons: This system allows the trolley to be disassembled in three pieces in a few seconds. Large wheels are preferred where Optimists are being launched from beaches or muddy slipways. Made of square Aluminum tube with rounded corners. All joints are welded and all surfaces on which the boat rests are padded with red pvc tubing. Support: The axle of the trolley is extended so the hull fits upside down between the wheels. Anodized: The whole frame is anodized to prevent corrosion.");
s++; item[s]=new Array("boat_-_optimist_accessories.html","../images/1119tmb.jpg","Boat - Optimist &#187 Accessories","£42.99 &#187 Optimist rudder and dagger bag","1119");
s++; item[s]=new Array("boat_-_optimist_accessories.html","../images/optimisthalyardlinetmb.jpg","Boat - Optimist &#187 Accessories","£8.99 &#187 Halyard line 3mm vectran halyard with 2 spliced loops","Halyard line 3mm vectran halyard with 2 spliced loops.This line can be weaved through the Harken blocks");
s++; item[s]=new Array("boat_-_optimist_accessories.html","../images/optimistvectranropetmb.gif","Boat - Optimist &#187 Accessories","£8.99 &#187 Vectran 1.2mm rope Quantity 15 metres","1367");
s++; item[s]=new Array("boat_-_optimist_accessories.html","../images/optimistvectranropetmb.gif","Boat - Optimist &#187 Accessories","£17.99 &#187 Vectran 3 mm rope Quantity 16 metres","1368");
s++; item[s]=new Array("boat_-_optimist_accessories.html","../images/optimistvectranropetmb.gif","Boat - Optimist &#187 Accessories","£26.50 &#187 Vectran 4 mm rope Quantity 12 metres","1369");
s++; item[s]=new Array("boat_-_optimist_accessories.html","../images/optimistdoubletaperedmainsheettmb.gif","Boat - Optimist &#187 Accessories","£39.50 &#187 Tapered mainsheet","Tapered mainsheet The ultimate Optimist mainsheet is tapered and made of abrasion resistant PES material.Tapered from 9 to 6.5mm.Double tapered.Just thick where it needs to be.");
s++; item[s]=new Array("boat_-_optimist_accessories.html","../images/optimistdvdfrontcovertmb.jpg","Boat - Optimist &#187 Accessories","£38.99 &#187 Optimist Optisailors.com DVD Advanced Optimist Boat Handling","1433");
s++; item[s]=new Array("boat_-_optimist_accessories.html","../images/praddletmb.jpg","Boat - Optimist &#187 Accessories","£6.50 &#187 Optimist Praddle","1440");
s++; item[s]=new Array("boat_-_optimist_accessories.html","../images/optimist35ltrhandbailergreentmb.jpg","Boat - Optimist &#187 Accessories","£5.99 &#187 Optimist 3.5L Hand Bailer","1442");
s++; item[s]=new Array("boat_-_optimist_accessories.html","../images/optpartslunchcontainertmb.gif","Boat - Optimist &#187 Accessories","£12.50 &#187 Optiparts heavy duty waterproof 3 litre barrel","Optiparts heavy duty waterproof 3 litre barrel Waterproof lunch container, stores your lunch or valuables dry. Keep the container in your own boat or in the coach boat. With a hole in the lid to attach a line. 17 cm high");
s++; item[s]=new Array("boat_-_optimist_accessories.html","../images/optpartslunchcontainertmb.gif","Boat - Optimist &#187 Accessories","£15.99 &#187 Optiparts heavy duty waterproof 6 litre barrel","Optiparts heavy duty waterproof 6 litre barrel Waterproof lunch container, stores your lunch or valuables dry. Keep the container in your own boat or in the coach boat. With a hole in the lid to attach a line. 26 cm high.");
s++; item[s]=new Array("boat_-_optimist_accessories.html","../images/magicmarineoptimistbumperboytmb.jpg","Boat - Optimist &#187 Accessories","£12.99 &#187 Optimist Magic Marine bow bumpers for boys","");
s++; item[s]=new Array("boat_-_optimist_accessories.html","../images/magicmarineoptimistbumpergirltmb.jpg","Boat - Optimist &#187 Accessories","£12.99 &#187 Optimist Magic Marine bow bumpers for girls","");
s++; item[s]=new Array("boat_-_optimist_accessories.html","../images/magicmarineoptimisttoestrapboytmb.jpg","Boat - Optimist &#187 Accessories","£12.99 &#187 Optimist Magic Marine hiking straps  boys","");
s++; item[s]=new Array("boat_-_optimist_accessories.html","../images/magicmarineoptimisttoestrapgirltmb.jpg","Boat - Optimist &#187 Accessories","£12.99 &#187 Optimist Magic Marine hiking straps  girls","");
s++; item[s]=new Array("boat_-_optimist_blocks_and_halyards.html","../images/optipartshullanddeckfttings1294tmb.jpeg","Boat - Optimist &#187 Blocks and halyards","£84.99 &#187 Optimist Frederikson Ratchet Block with 2 way link","1294");
s++; item[s]=new Array("boat_-_optimist_blocks_and_halyards.html","../images/optipartshullanddeckfttings1314tmb.jpeg","Boat - Optimist &#187 Blocks and halyards","£26.99 &#187 Optimist Ronstan block with becket plus wire","1314");
s++; item[s]=new Array("boat_-_optimist_blocks_and_halyards.html","../images/1334tmb.jpg","Boat - Optimist &#187 Blocks and halyards","£10.99 &#187 Harken micro block","1334");
s++; item[s]=new Array("boat_-_optimist_blocks_and_halyards.html","../images/1352tmb.jpg","Boat - Optimist &#187 Blocks and halyards","£42.99 &#187 Optimist Halyard Complete with ex1340h block","1352");
s++; item[s]=new Array("boat_-_optimist_blocks_and_halyards.html","../images/1353tmb.jpg","Boat - Optimist &#187 Blocks and halyards","£8.99 &#187 Optimist Replacement halyard line","1353");
s++; item[s]=new Array("boat_-_optimist_blocks_and_halyards.html","../images/1351htmb.jpg","Boat - Optimist &#187 Blocks and halyards","£23.99 &#187 Optimist Ball bearing hook in block for Black Gold Mast","1351h");
s++; item[s]=new Array("boat_-_optimist_covers_and_bags.html","../images/magicmarinelaser1rolledsailbagtmb.jpg","Boat - Optimist &#187 Covers and bags","£15.99 &#187 Optimist Magic Marine sail bag","");
s++; item[s]=new Array("boat_-_optimist_covers_and_bags.html","../images/magicmarineoptimistrigbagtmb.jpg","Boat - Optimist &#187 Covers and bags","£42.99 &#187 Optimist Magic Marine foils and tiller bag","");
s++; item[s]=new Array("boat_-_optimist_covers_and_bags.html","../images/magicmarinedeckcoveroppiegirlstmb.jpg","Boat - Optimist &#187 Covers and bags","£94.99 &#187 Optimist Magic Marine top cover girls","");
s++; item[s]=new Array("boat_-_optimist_covers_and_bags.html","../images/magicmarineoptimistdeckboystmb.jpg","Boat - Optimist &#187 Covers and bags","£94.99 &#187 Optimist Magic Marine top cover boys","");
s++; item[s]=new Array("boat_-_optimist_covers_and_bags.html","../images/magicmarineoptimistbottomcoverboytmb.jpg","Boat - Optimist &#187 Covers and bags","£99.99 &#187 Optimist Magic Marine bottom cover  boys","");
s++; item[s]=new Array("boat_-_optimist_covers_and_bags.html","../images/magicmarineoptimistbottomcovergirltmb.jpg","Boat - Optimist &#187 Covers and bags","£99.99 &#187 Optimist Magic Marine bottom cover girls","");
s++; item[s]=new Array("boat_-_optimist_foils_tillers_etc.html","../images/optipartrubberinserttmb.gif","Boat - Optimist &#187 Foils tillers etc","£2.80 &#187 Optimist Rubber Insert Only","1116");
s++; item[s]=new Array("boat_-_optimist_foils_tillers_etc.html","../images/optipartsfoilsetc1117tmb.jpeg","Boat - Optimist &#187 Foils tillers etc","£18.99 &#187 Optimist Complete Protecting Kit","1117");
s++; item[s]=new Array("boat_-_optimist_foils_tillers_etc.html","../images/1122tmb.jpg","Boat - Optimist &#187 Foils tillers etc","£19.99 &#187 Tiller black anodised","1122");
s++; item[s]=new Array("boat_-_optimist_foils_tillers_etc.html","../images/1140tmb.jpg","Boat - Optimist &#187 Foils tillers etc","£20.99 &#187 Optimist Tiller Extension","1140");
s++; item[s]=new Array("boat_-_optimist_foils_tillers_etc.html","../images/optipartsfoilsetc1140tmb.jpeg","Boat - Optimist &#187 Foils tillers etc","£21.99 &#187 Optimist Deluxe Tiller Extension","1141");
s++; item[s]=new Array("boat_-_optimist_foils_tillers_etc.html","../images/optipartsfoilsetc652948tmb.jpeg","Boat - Optimist &#187 Foils tillers etc","£6.99 &#187 Optimist Universal Joint with rope core, fixed base","652948");
s++; item[s]=new Array("boat_-_optimist_foils_tillers_etc.html","../images/optipartsfoilsetc652950tmb.jpeg","Boat - Optimist &#187 Foils tillers etc","£7.99 &#187 Optimist Releaseable Joint","652950");
s++; item[s]=new Array("boat_-_optimist_hull_and_deck_fittings.html","../images/1113tmb.jpg","Boat - Optimist &#187 Hull and deck fittings","£6.99 &#187 Daggerboard bungy system","1113");
s++; item[s]=new Array("boat_-_optimist_hull_and_deck_fittings.html","../images/optipartshullanddeckfttings1155tmb.jpeg","Boat - Optimist &#187 Hull and deck fittings","£1.99 &#187 Optimist 12 Bolts and Self Locking Nuts","1155");
s++; item[s]=new Array("boat_-_optimist_hull_and_deck_fittings.html","../images/optipartspintlestmb.gif","Boat - Optimist &#187 Hull and deck fittings","£13.99 &#187 Optimist Optiparts Rudder Pintles 1x long 1x short","1160");
s++; item[s]=new Array("boat_-_optimist_hull_and_deck_fittings.html","../images/optipartsgudgeonplatetmb.gif","Boat - Optimist &#187 Hull and deck fittings","£11.99 &#187 Optimist Transom Guddeons with backing plates","1170");
s++; item[s]=new Array("boat_-_optimist_hull_and_deck_fittings.html","../images/optipartsrudderretainertmb.gif","Boat - Optimist &#187 Hull and deck fittings","£3.99 &#187 Optimist Rudder Retaining Clip","1180");
s++; item[s]=new Array("boat_-_optimist_hull_and_deck_fittings.html","../images/optipartshullanddeckfttings1200tmb.jpeg","Boat - Optimist &#187 Hull and deck fittings","£39.99 &#187 Optimist Adjustable Mast Step. Racing type with pin","1200");
s++; item[s]=new Array("boat_-_optimist_hull_and_deck_fittings.html","../images/optipartshullanddeckfttings1202tmb.jpeg","Boat - Optimist &#187 Hull and deck fittings","£34.99 &#187 Optimist Adjustable Mast Step. Round type","1202");
s++; item[s]=new Array("boat_-_optimist_hull_and_deck_fittings.html","../images/1209tmb.jpg","Boat - Optimist &#187 Hull and deck fittings","£7.99 &#187 Low friction racing collar","1209");
s++; item[s]=new Array("boat_-_optimist_hull_and_deck_fittings.html","../images/optipartshullanddeckfttings1210tmb.jpeg","Boat - Optimist &#187 Hull and deck fittings","£9.99 &#187 Optimist Deck Collar with Mast Sleeve","1210");
s++; item[s]=new Array("boat_-_optimist_hull_and_deck_fittings.html","../images/optipartshullanddeckfttings1216tmb.jpeg","Boat - Optimist &#187 Hull and deck fittings","£23.99 &#187 Optimist Buoyancy Bag","1217");
s++; item[s]=new Array("boat_-_optimist_hull_and_deck_fittings.html","../images/1339tmb.jpg","Boat - Optimist &#187 Hull and deck fittings","£1.65 &#187 Lacing eye","1339");
s++; item[s]=new Array("boat_-_optimist_hull_and_deck_fittings.html","../images/1412tmb.jpg","Boat - Optimist &#187 Hull and deck fittings","£3.50 &#187 Base plate fixed","1412");
s++; item[s]=new Array("boat_-_optimist_hull_and_deck_fittings.html","../images/1414tmb.jpg","Boat - Optimist &#187 Hull and deck fittings","£1.50 &#187 Small deck eye","1414");
s++; item[s]=new Array("boat_-_optimist_hull_and_deck_fittings.html","../images/1414tmb.jpg","Boat - Optimist &#187 Hull and deck fittings","£1.50 &#187 Large eye 5mm holes","1415");
s++; item[s]=new Array("boat_-_optimist_hull_and_deck_fittings.html","../images/optipartshullanddeckfttings1444tmb.jpeg","Boat - Optimist &#187 Hull and deck fittings","£3.50 &#187 Optimist Small Hand Bailer","1444");
s++; item[s]=new Array("boat_-_optimist_spars_fittings_sails.html","../images/900tmb.jpg","Boat - Optimist &#187 Spars fittings sails","£278.99 &#187 Optimist Black Gold Mast Including Rig Pack","900");
s++; item[s]=new Array("boat_-_optimist_spars_fittings_sails.html","../images/940tmb.jpg","Boat - Optimist &#187 Spars fittings sails","£96.99 &#187 Optimist Black Gold Boom The 40 mm BLACKGOLD boom","Optimist Black Gold Boom The 40 mm BLACKGOLD boom A stiff and lightweight boom, which comes with a bridle and suitable for the majority of sailors.");
s++; item[s]=new Array("boat_-_optimist_spars_fittings_sails.html","../images/960tmb.jpg","Boat - Optimist &#187 Spars fittings sails","£63.99 &#187 Optimist Black Gold Sprit","960");
s++; item[s]=new Array("boat_-_optimist_spars_fittings_sails.html","../images/optipracingsailtmb.gif","Boat - Optimist &#187 Spars fittings sails","£237.99 &#187 Optimist Windesign Racing Sail","Optimist Windesign Racing Sail Windesign Racing Sail Dos (Over 45 Kg) Ref: 1058 Windesign DOS for sailors over 45KG (99 lbs). Windesign Racing Sail Uno (Under 45 Kg) Ref: 1057 Windesign UNO for sailors under 45 KG (99 lbs) Build for speed ! Great care has been taken on each cut and stitch. Made of Polyant 140 B sailcloth. One of the best sailcloths available worldwide. Easy to trim 6 panel horizontal design. With tapered sailbattens Telltales and window installed. Includes Vectron sail tie kit, sail bag and IODA button.");
s++; item[s]=new Array("boat_-_optimist_spars_fittings_sails.html","../images/optipartssparssailsfittings1203tmb.jpeg","Boat - Optimist &#187 Spars fittings sails","£16.50 &#187 Optimist Optiparts Mast Lock","1203");
s++; item[s]=new Array("boat_-_optimist_spars_fittings_sails.html","../images/optipartssleevetmb.gif","Boat - Optimist &#187 Spars fittings sails","£399.00 &#187 Optimist Mast Sleeve Only","1211");
s++; item[s]=new Array("boat_-_optimist_spars_fittings_sails.html","../images/optipartssparssailsfittings1240tmb.jpeg","Boat - Optimist &#187 Spars fittings sails","£8.99 &#187 Optimist Standard Wind Indication","1240");
s++; item[s]=new Array("boat_-_optimist_spars_fittings_sails.html","../images/1242tmb.jpg","Boat - Optimist &#187 Spars fittings sails","£9.99 &#187 Optimist Racing Wind Indication","1242");
s++; item[s]=new Array("boat_-_optimist_spars_fittings_sails.html","../images/1245tmb.jpg","Boat - Optimist &#187 Spars fittings sails","£2.50 &#187 Wind indicator holder for school mast","1245");
s++; item[s]=new Array("boat_-_optimist_spars_fittings_sails.html","../images/1255tmb.jpg","Boat - Optimist &#187 Spars fittings sails","£14.00 &#187 Pin type heel plug for racing mast","1255");
s++; item[s]=new Array("boat_-_optimist_spars_fittings_sails.html","../images/1256tmb.jpg","Boat - Optimist &#187 Spars fittings sails","£16.99 &#187 High heel low friction delrin","1256");
s++; item[s]=new Array("boat_-_optimist_spars_fittings_sails.html","../images/1257tmb.jpg","Boat - Optimist &#187 Spars fittings sails","£3.99 &#187 Heel plug heavy duty","1257");
s++; item[s]=new Array("boat_-_optimist_spars_fittings_sails.html","../images/optipartshullanddeckfttings1270tmb.jpeg","Boat - Optimist &#187 Spars fittings sails","£7.50 &#187 Optimist Sprit end for 22mm sprit","1270");
s++; item[s]=new Array("boat_-_optimist_spars_fittings_sails.html","../images/optipartshullanddeckfttings1271tmb.jpeg","Boat - Optimist &#187 Spars fittings sails","£9.99 &#187 Optimist Sprit end for 27mm sprit","1271");
s++; item[s]=new Array("boat_-_optimist_spars_fittings_sails.html","../images/1275tmb.jpg","Boat - Optimist &#187 Spars fittings sails","£11.99 &#187 Inboard end for 32mm standard boom","1275");
s++; item[s]=new Array("boat_-_optimist_spars_fittings_sails.html","../images/1280tmb.jpg","Boat - Optimist &#187 Spars fittings sails","£11.98 &#187 Optimist Inboard end for 40mm racing boom","1280");
s++; item[s]=new Array("boat_-_optimist_spars_fittings_sails.html","../images/1281tmb.jpg","Boat - Optimist &#187 Spars fittings sails","£14.99 &#187 Optimist Inboard end for 55mm racing boom","1281");
s++; item[s]=new Array("boat_-_optimist_spars_fittings_sails.html","../images/optipartshullanddeckfttings1282tmb.jpeg","Boat - Optimist &#187 Spars fittings sails","£8.99 &#187 Optimist Outboard end for 40mm racing boom","1282");
s++; item[s]=new Array("boat_-_optimist_spars_fittings_sails.html","../images/1283tmb.jpg","Boat - Optimist &#187 Spars fittings sails","£9.50 &#187 Optimist Outboard end for 55mm racing boom","1283");
s++; item[s]=new Array("boat_-_optimist_spars_fittings_sails.html","../images/1290tmb.jpg","Boat - Optimist &#187 Spars fittings sails","£6.99 &#187 Mast flotation set - 3 pieces","1290");
s++; item[s]=new Array("boat_-_optimist_spars_fittings_sails.html","../images/1301tmb.jpg","Boat - Optimist &#187 Spars fittings sails","£1.99 &#187 plate shackle 4mm pin","1301");
s++; item[s]=new Array("boat_-_optimist_spars_fittings_sails.html","../images/1301tmb.jpg","Boat - Optimist &#187 Spars fittings sails","£1.99 &#187 plate shackle 5mm pin","1302");
s++; item[s]=new Array("boat_-_optimist_spars_fittings_sails.html","../images/1337tmb.jpg","Boat - Optimist &#187 Spars fittings sails","£3.99 &#187 Optimist Aluminium pin stop","1337");
s++; item[s]=new Array("boat_-_optimist_spars_fittings_sails.html","../images/optipartssparssailsfittings1338tmb.jpeg","Boat - Optimist &#187 Spars fittings sails","£6.99 &#187 Optimist Optipartspennant holders","1338");
s++; item[s]=new Array("boat_-_optimist_spars_fittings_sails.html","../images/optipartssparssailsfittings1354tmb.jpeg","Boat - Optimist &#187 Spars fittings sails","£3.50 &#187 Optimist Nylon Sprit Adjuster handle","1354");
s++; item[s]=new Array("boat_-_optimist_spars_fittings_sails.html","../images/1358gtmb.jpg","Boat - Optimist &#187 Spars fittings sails","£0.99 &#187 Calibration strips","1358");
s++; item[s]=new Array("boat_-_optimist_spars_fittings_sails.html","../images/optipartssparssailsfittings1364tmb.jpeg","Boat - Optimist &#187 Spars fittings sails","£11.99 &#187 Optimist Vang for 34 to 40 mm booms","1364");
s++; item[s]=new Array("boat_-_optimist_spars_fittings_sails.html","../images/optipartssparssailsfittings1365tmb.jpeg","Boat - Optimist &#187 Spars fittings sails","£11.99 &#187 Optimist Vang for 55mm booms","1365");
s++; item[s]=new Array("boat_-_optimist_spars_fittings_sails.html","../images/optipartssparssailsfittings1367tmb.jpeg","Boat - Optimist &#187 Spars fittings sails","£8.99 &#187 Optimist Mini Reel 1.4mm Vectran","1367");
s++; item[s]=new Array("boat_-_optimist_spars_fittings_sails.html","../images/optipartssparssailsfittings1371tmb.jpeg","Boat - Optimist &#187 Spars fittings sails","£6.99 &#187 Optimist Stainless Seel Safety Snap Shackle","Optimist Stainless Seel Safety Snap Shackle Small stainless steel safety snap shackle for the mainsheet. Length 43 mm, weighs just 16 grams.");
s++; item[s]=new Array("boat_-_optimist_spars_fittings_sails.html","../images/optipartssparssailsfittings1372tmb.jpeg","Boat - Optimist &#187 Spars fittings sails","£5.99 &#187 Optimist Trigger Snap Safety Snap Shackle","Optimist Trigger Snap Safety Snap ShackleStainless steel 316 trigger snap safety snap shackle. Can be opened with one hand. Length 49 mm, weights 20 gr.");
s++; item[s]=new Array("boat_-_optimist_spars_fittings_sails.html","../images/1373tmb.jpg","Boat - Optimist &#187 Spars fittings sails","£6.99 &#187 Optimist Protest Flag","1373");
s++; item[s]=new Array("boat_-_topper__centre_main.html","../images/toppercmainboomblockwebbingstraptmb.jpg","Boat - Topper  &#187 Centre Main","£4.99 &#187 WEBBING STRAP - attaching the forward boom block","");
s++; item[s]=new Array("boat_-_topper__centre_main.html","../images/toppercmainboomcover2tmb.jpg","Boat - Topper  &#187 Centre Main","£4.99 &#187 Boom Cover for centre main","");
s++; item[s]=new Array("boat_-_topper__centre_main.html","../images/toppercentremainkittmb.jpg","Boat - Topper  &#187 Centre Main","£127.22 &#187 Topper Centre Mainsheet Kit","W39/1");
s++; item[s]=new Array("boat_-_topper__controls.html","../images/englishbraidscruisingdyneematmb.jpg","Boat - Topper  &#187 Controls","£2.30 &#187 Cruising dyneema 6mm .Very popular with topper sailors as mainsheet.","Designed to provide a halfway house to the average sailor, the cruising Dyneema has proved to be an outstanding success. With lower water pick up, low stretch and brilliant handling characteristics the line has been widely accepted on both dingy and cruising boats. Critically the design has been focused on ensuring ease of splicing and workability. Covered in the standard 24 plait polyester cover, used for EB Braid on Braid, the Dyneema core is protected against heat and abrasion.Breaking load 1300kg.");
s++; item[s]=new Array("boat_-_topper__controls.html","../images/roosterropetmb.gif","Boat - Topper  &#187 Controls","£1.30 &#187 7mm rooster rope","The rope has a light high stretch inner core which leaves the outer core to be the load bearer.Due to the unique design the outer core takes the load instead of the inner core.This helps to maintain stability and prevents the rope from tangling.");
s++; item[s]=new Array("boat_-_topper__controls.html","../images/topperaccessoriesk17tmb.jpg","Boat - Topper  &#187 Controls","£5.45 &#187 Bow painter","K17");
s++; item[s]=new Array("boat_-_topper__controls.html","../images/topperaccessoriesk23tmb.jpg","Boat - Topper  &#187 Controls","£10.95 &#187 Downhaul assembly with hook","K23");
s++; item[s]=new Array("boat_-_topper__controls.html","../images/topperaccessoriesk22bwtmb.jpg","Boat - Topper  &#187 Controls","£6.55 &#187 Halyard strop","K22BW");
s++; item[s]=new Array("boat_-_topper__controls.html","../images/topperaccessoriesd9tmb.jpg","Boat - Topper  &#187 Controls","£12.05 &#187 Jamming block for kicker","D9");
s++; item[s]=new Array("boat_-_topper__controls.html","../images/topperaccessoriesk20tmb.jpg","Boat - Topper  &#187 Controls","£10.95 &#187 Outhaul assembly complete with stainless steel carabina","K20");
s++; item[s]=new Array("boat_-_topper__controls.html","../images/topperaccessoriesk46tmb.jpg","Boat - Topper  &#187 Controls","£9.85 &#187 Stainless steel carabina","K46");
s++; item[s]=new Array("boat_-_topper__controls.html","../images/topperaccessoriesk7bwtmb.jpg","Boat - Topper  &#187 Controls","£16.45 &#187 Traveller rope with traveller cleat and roller","K7BW");
s++; item[s]=new Array("boat_-_topper__controls.html","../images/topperaccessoriesk4tmb.jpg","Boat - Topper  &#187 Controls","£16.45 &#187 Shackle K4 for ST112, 114, D9","K4");
s++; item[s]=new Array("boat_-_topper__controls.html","../images/toppercontrolsk4tmb.gif","Boat - Topper  &#187 Controls","£3.25 &#187 Topper Shackle for ST112,114,D9","K4");
s++; item[s]=new Array("boat_-_topper__controls.html","../images/toppercontrolss36tmb.gif","Boat - Topper  &#187 Controls","£6.00 &#187 Topper Stainless steel hook","TC158");
s++; item[s]=new Array("boat_-_topper__controls.html","../images/toppercontrolsst112tmb.gif","Boat - Topper  &#187 Controls","£9.99 &#187 Topper Upper Block and Shackle","ST112");
s++; item[s]=new Array("boat_-_topper__controls.html","../images/toppercontrolsst114tmb.gif","Boat - Topper  &#187 Controls","£10.95 &#187 Topper Lower Block, Becket and Shackle","ST114");
s++; item[s]=new Array("boat_-_topper__controls.html","../images/toppercontrolsk19tmb.gif","Boat - Topper  &#187 Controls","£27.45 &#187 Topper Kicking Strap Assembly","K19");
s++; item[s]=new Array("boat_-_topper__controls.html","../images/toppercontrolsk1tmb.gif","Boat - Topper  &#187 Controls","£43.95 &#187 Topper Mainsheet Assembly Complete","K19");
s++; item[s]=new Array("boat_-_topper__controls.html","../images/topperhalyardlooptmb.jpg","Boat - Topper  &#187 Controls","£6.55 &#187 Halyard loop complete","K22BW");
s++; item[s]=new Array("boat_-_topper__controls.html","../images/topperclewstraptmb.jpeg","Boat - Topper  &#187 Controls","£7.65 &#187 Topper clewstrop","K21");
s++; item[s]=new Array("boat_-_topper__foils_tillers_etc.html","../images/topperfoilstopaztoppern1atmb.gif","Boat - Topper  &#187 Foils tillers etc","£4.35 &#187 nylon bush pack of 2","N1A");
s++; item[s]=new Array("boat_-_topper__foils_tillers_etc.html","../images/topperaccessoriesc9tmb.jpg","Boat - Topper  &#187 Foils tillers etc","£3.25 &#187 Black nut cover pack of 2","C9");
s++; item[s]=new Array("boat_-_topper__foils_tillers_etc.html","../images/topperaccessoriesc26tmb.jpg","Boat - Topper  &#187 Foils tillers etc","£8.00 &#187 Daggerboard shock cord assembly with nylon clip","C26");
s++; item[s]=new Array("boat_-_topper__foils_tillers_etc.html","../images/topperaccessoriesfh3tmb.jpg","Boat - Topper  &#187 Foils tillers etc","£5.45 &#187 Fittings for rudder assembly","F/H3");
s++; item[s]=new Array("boat_-_topper__foils_tillers_etc.html","../images/topperaccessoriesfm5tmb.jpg","Boat - Topper  &#187 Foils tillers etc","£6.55 &#187 Fittings for tiller","F/M5");
s++; item[s]=new Array("boat_-_topper__foils_tillers_etc.html","../images/topperaccessoriesh13tmb.jpg","Boat - Topper  &#187 Foils tillers etc","£4.35 &#187 Gudgeon pin","H13");
s++; item[s]=new Array("boat_-_topper__foils_tillers_etc.html","../images/topperaccessoriesfh3tmb.jpg","Boat - Topper  &#187 Foils tillers etc","£130.00 &#187 Rudder blade","H3");
s++; item[s]=new Array("boat_-_topper__foils_tillers_etc.html","../images/topperfoilsh16tmb.gif","Boat - Topper  &#187 Foils tillers etc","£32.95 &#187 Topper Rudder Stock Casting Including Bush","H16");
s++; item[s]=new Array("boat_-_topper__foils_tillers_etc.html","../images/toppertillerextensiontmb.jpg","Boat - Topper  &#187 Foils tillers etc","£32.95 &#187 Topper Tiller Extension with fittings","H9/1");
s++; item[s]=new Array("boat_-_topper__foils_tillers_etc.html","../images/toppertillertmb.jpg","Boat - Topper  &#187 Foils tillers etc","£44.99 &#187 Topper Tiller Arm","");
s++; item[s]=new Array("boat_-_topper__foils_tillers_etc.html","../images/toppertillerandextensiontmb.jpg","Boat - Topper  &#187 Foils tillers etc","£65.95 &#187 Topper Tiller and Extension","H5A");
s++; item[s]=new Array("boat_-_topper__foils_tillers_etc.html","../images/topperfoilsh20stocktmb.gif","Boat - Topper  &#187 Foils tillers etc","£160.00 &#187 Topper Rudder Blade and Stock","H20");
s++; item[s]=new Array("boat_-_topper__foils_tillers_etc.html","../images/topperfoilsh21tmb.gif","Boat - Topper  &#187 Foils tillers etc","£220.00 &#187 Topper Rudder Blade Stock and tiller assembly","H21");
s++; item[s]=new Array("boat_-_topper__foils_tillers_etc.html","../images/topperfoilsj1tmb.gif","Boat - Topper  &#187 Foils tillers etc","£195.00 &#187 Topper dagger board","J1");
s++; item[s]=new Array("boat_-_topper__hull_and_hull_parts.html","../images/topperaccessoriesm7tmb.jpg","Boat - Topper  &#187 Hull and hull parts","£6.55 &#187 Daggerboard gasket","M8");
s++; item[s]=new Array("boat_-_topper__hull_and_hull_parts.html","../images/topperdaggerboardmouldingstmb.jpg","Boat - Topper  &#187 Hull and hull parts","£29.95 &#187 Topper Insert Pack (Daggerboard Case)","A3A");
s++; item[s]=new Array("boat_-_topper__hull_and_hull_parts.html","../images/topperhullanddeckfittingsc6tmb.gif","Boat - Topper  &#187 Hull and hull parts","£2.15 &#187 Topper Toestrap Plate","C6");
s++; item[s]=new Array("boat_-_topper__hull_and_hull_parts.html","../images/topperhullanddeckfittingsc14atmb.gif","Boat - Topper  &#187 Hull and hull parts","£2.95 &#187 Topper P-Clips (2)","C14A");
s++; item[s]=new Array("boat_-_topper__hull_and_hull_parts.html","../images/topperhullanddeckfittingsc181tmb.gif","Boat - Topper  &#187 Hull and hull parts","£6.55 &#187 Topper Self Bailor Gasket (Small)","C18/1");
s++; item[s]=new Array("boat_-_topper__hull_and_hull_parts.html","../images/topperhullanddeckfittingsm9tmb.gif","Boat - Topper  &#187 Hull and hull parts","£3.25 &#187 Topper Self Bailor Gasket (Large)","M9");
s++; item[s]=new Array("boat_-_topper__hull_and_hull_parts.html","../images/toppertravellerronstanbungtmb.jpg","Boat - Topper  &#187 Hull and hull parts","£4.35 &#187 Topper bung","B10/1");
s++; item[s]=new Array("boat_-_topper__hull_and_hull_parts.html","../images/topperhullanddeckfittinggudgeonplatetmb.gif","Boat - Topper  &#187 Hull and hull parts","£5.45 &#187 Topper Gudgeon Plate","N2");
s++; item[s]=new Array("boat_-_topper__hull_and_hull_parts.html","../images/topperhullanddeckfittingsb5atmb.gif","Boat - Topper  &#187 Hull and hull parts","£5.45 &#187 Topper Mastgate lanyard with toggles","B5A");
s++; item[s]=new Array("boat_-_topper__hull_and_hull_parts.html","../images/topperhullanddeckfittingsc3tmb.gif","Boat - Topper  &#187 Hull and hull parts","£5.45 &#187 Topper Mainsheet Traveller Jam Cleat","C3");
s++; item[s]=new Array("boat_-_topper__hull_and_hull_parts.html","../images/topperhullanddeckfittingsc5atstrapassembwplatestmb.gif","Boat - Topper  &#187 Hull and hull parts","£16.45 &#187 Topper centre Toestrap Assembly","W38");
s++; item[s]=new Array("boat_-_topper__hull_and_hull_parts.html","../images/toppertravellercleatrollertmb.jpg","Boat - Topper  &#187 Hull and hull parts","£9.95 &#187 Topper Traveller Cleat/Roller","");
s++; item[s]=new Array("boat_-_topper__hull_and_hull_parts.html","../images/topperhullanddeckfittingscentretoestrapw38atmb.gif","Boat - Topper  &#187 Hull and hull parts","£11.95 &#187 Topper side Toestrap Assembly unpadded","");
s++; item[s]=new Array("boat_-_topper__hull_and_hull_parts.html","../images/topperhullanddeckfittingsa6aftmb.gif","Boat - Topper  &#187 Hull and hull parts","£15.00 &#187 Topper Mast Step Cup Assembly","A6AF");
s++; item[s]=new Array("boat_-_topper__hull_and_hull_parts.html","../images/topperhullanddeckfittingstt9Atmb.gif","Boat - Topper  &#187 Hull and hull parts","£18.75 &#187 Topper Transom Inner Plate","TT9A");
s++; item[s]=new Array("boat_-_topper__hull_and_hull_parts.html","../images/topperhullanddeckfittingsa4tmb.gif","Boat - Topper  &#187 Hull and hull parts","£21.95 &#187 Topper Hull Plate","A4");
s++; item[s]=new Array("boat_-_topper__hull_and_hull_parts.html","../images/topperaccessoriesw12btmb.gif","Boat - Topper  &#187 Hull and hull parts","£22.95 &#187 Topper Padded Centre Toestrap","W12B");
s++; item[s]=new Array("boat_-_topper__hull_and_hull_parts.html","../images/topperhullanddeckfittingsc18tmb.gif","Boat - Topper  &#187 Hull and hull parts","£32.00 &#187 Topper Self Bailer excluding gasket","CA8");
s++; item[s]=new Array("boat_-_topper__hull_and_hull_parts.html","../images/topperhullanddeckfittingstt10tmb.gif","Boat - Topper  &#187 Hull and hull parts","£41.75 &#187 Topper Transom Plate","TT10");
s++; item[s]=new Array("boat_-_topper__hull_and_hull_parts.html","../images/topperhullanddeckfittingsb1atmb.gif","Boat - Topper  &#187 Hull and hull parts","£43.95 &#187 Topper Mastgate Assembly complete with lanyard, toggles and screws","B1A");
s++; item[s]=new Array("boat_-_topper__hull_and_hull_parts.html","../images/topperaccessoriesw13btmb.gif","Boat - Topper  &#187 Hull and hull parts","£35.95 &#187 Topper Padded Side Toestraps (Pair)","W13B");
s++; item[s]=new Array("boat_-_topper__sail_numbers_and_gbrs.html","../images/sailnumbersdigital8s230mmtmb.jpg","Boat - Topper  &#187 Sail numbers and GBRs","£1.75 &#187 digital 8s 230mm","<a href=http://www.jonti.co.uk/html/topperchampionshipnumbers.pdf>Click here</a> for a PDF information sheet on how to number sail with Topper Championship numbers.");
s++; item[s]=new Array("boat_-_topper__sail_numbers_and_gbrs.html","../images/sailnumbers230mmtmb.jpg","Boat - Topper  &#187 Sail numbers and GBRs","£1.75 &#187 Sail numbers and GBRs 230mm","<a href=http://www.jonti.co.uk/html/topperchampionshipnumbers.pdf>Click here</a> for a PDF information sheet on how to number sail with Topper Championship numbers.");
s++; item[s]=new Array("boat_-_topper__sail_numbers_and_gbrs.html","../images/sailnumbers230mmtmb.jpg","Boat - Topper  &#187 Sail numbers and GBRs","£1.75 &#187 Sail numbers and GBRs 230mm","<a href=http://www.jonti.co.uk/html/topperchampionshipnumbers.pdf>Click here</a> for a PDF information sheet on how to number sail with Topper Championship numbers.");
s++; item[s]=new Array("boat_-_topper__sail_numbers_and_gbrs.html","../images/sailnumbers230mmtmb.jpg","Boat - Topper  &#187 Sail numbers and GBRs","£1.75 &#187 Sail numbers and GBRs 230mm","<a href=http://www.jonti.co.uk/html/topperchampionshipnumbers.pdf>Click here</a> for a PDF information sheet on how to number sail with Topper Championship numbers.");
s++; item[s]=new Array("boat_-_topper__sail_numbers_and_gbrs.html","../images/sailnumbers230mmtmb.jpg","Boat - Topper  &#187 Sail numbers and GBRs","£1.75 &#187 Sail numbers and GBRs 230mm","<a href=http://www.jonti.co.uk/html/topperchampionshipnumbers.pdf>Click here</a> for a PDF information sheet on how to number sail with Topper Championship numbers.");
s++; item[s]=new Array("boat_-_topper__sail_numbers_and_gbrs.html","../images/sailnumbers230mmtmb.jpg","Boat - Topper  &#187 Sail numbers and GBRs","£1.75 &#187 Sail numbers and GBRs 230mm","<a href=http://www.jonti.co.uk/html/topperchampionshipnumbers.pdf>Click here</a> for a PDF information sheet on how to number sail with Topper Championship numbers.");
s++; item[s]=new Array("boat_-_topper__sail_numbers_and_gbrs.html","../images/sailnumbers230mmtmb.jpg","Boat - Topper  &#187 Sail numbers and GBRs","£1.75 &#187 Sail numbers and GBRs 230mm","<a href=http://www.jonti.co.uk/html/topperchampionshipnumbers.pdf>Click here</a> for a PDF information sheet on how to number sail with Topper Championship numbers.");
s++; item[s]=new Array("boat_-_topper__sail_numbers_and_gbrs.html","../images/sailnumbers230mmtmb.jpg","Boat - Topper  &#187 Sail numbers and GBRs","£1.75 &#187 Sail numbers and GBRs 230mm","<a href=http://www.jonti.co.uk/html/topperchampionshipnumbers.pdf>Click here</a> for a PDF information sheet on how to number sail with Topper Championship numbers.");
s++; item[s]=new Array("boat_-_topper__sail_numbers_and_gbrs.html","../images/sailnumbers230mmtmb.jpg","Boat - Topper  &#187 Sail numbers and GBRs","£1.75 &#187 Sail numbers and GBRs 230mm","<a href=http://www.jonti.co.uk/html/topperchampionshipnumbers.pdf>Click here</a> for a PDF information sheet on how to number sail with Topper Championship numbers.");
s++; item[s]=new Array("boat_-_topper__sails.html","../images/toppersmallmaintmb.jpg","Boat - Topper  &#187 Sails","£142.95 &#187 Topper Sail 4.2 ROLLED RED/BLUE","W60RBF/1SE");
s++; item[s]=new Array("boat_-_topper__sails.html","../images/toppermainsailtmb.jpg","Boat - Topper  &#187 Sails","£192.45 &#187 Topper sail 5.3 ROLLED RED/BLUE","W60RBF/SE");
s++; item[s]=new Array("boat_-_topper__screws_rivots_etc.html","../images/toppermastrivotpacktmb.jpg","Boat - Topper  &#187 Screws Rivots etc","£4.95 &#187 Topper Mast Rivot Pack of 10","");
s++; item[s]=new Array("boat_-_topper__screws_rivots_etc.html","../images/topperoversizeinsertstmb.jpg","Boat - Topper  &#187 Screws Rivots etc","£4.95 &#187 Topper Oversize Insert Pack of 4","Y17");
s++; item[s]=new Array("boat_-_topper__screws_rivots_etc.html","../images/topperscrewsnutsrivotsy15horsetmb.gif","Boat - Topper  &#187 Screws Rivots etc","£4.95 &#187 Topper Traveller Cleat Screw bag","Y15");
s++; item[s]=new Array("boat_-_topper__screws_rivots_etc.html","../images/topperstdinsertstmb.jpg","Boat - Topper  &#187 Screws Rivots etc","£4.95 &#187 Insert pack Contains 10 inserts","Y16");
s++; item[s]=new Array("boat_-_topper__screws_rivots_etc.html","../images/topperthullplatescrewstmb.jpg","Boat - Topper  &#187 Screws Rivots etc","£6.55 &#187 Hull plate screw pack contains 20 screws","Y12");
s++; item[s]=new Array("boat_-_topper__screws_rivots_etc.html","../images/toppertransomplatescrewtmb.jpg","Boat - Topper  &#187 Screws Rivots etc","£6.55 &#187 Transom plate screw pack Contains 10 screws","Y11");
s++; item[s]=new Array("boat_-_topper__screws_rivots_etc.html","../images/toppertoestrapscrewstmb.jpg","Boat - Topper  &#187 Screws Rivots etc","£6.55 &#187 toestrap screw pk Contains 10 screws","Y13");
s++; item[s]=new Array("boat_-_topper__screws_rivots_etc.html","../images/topperdaggerboardcaseinsertstmb.jpg","Boat - Topper  &#187 Screws Rivots etc","£6.55 &#187 Insert pack (daggerboard case) Contains 10 inserts and 10 washers","Y20");
s++; item[s]=new Array("boat_-_topper__screws_rivots_etc.html","../images/topperscrewsnutsrivotsy14mastgatetmb.gif","Boat - Topper  &#187 Screws Rivots etc","£5.99 &#187 mastgate screw pk contains 11 screws","Y14");
s++; item[s]=new Array("boat_-_topper__screws_rivots_etc.html","../images/topperselbailernutsandboltstmb.jpg","Boat - Topper  &#187 Screws Rivots etc","£6.95 &#187 Gudgeon plate/ self bailor screw pack Contains 10 screws and 10 nuts","Y10");
s++; item[s]=new Array("boat_-_topper__spars_and_spar_fittings.html","../images/toppergooseneckboominsertonlytmb.jpg","Boat - Topper  &#187 Spars and spar fittings","£1.99 &#187 Boom Insert for Gooseneck","");
s++; item[s]=new Array("boat_-_topper__spars_and_spar_fittings.html","../images/toppersparsg5-6tmb.gif","Boat - Topper  &#187 Spars and spar fittings","£7.65 &#187 Topper Gooseneck and Boom Plug","G5/6");
s++; item[s]=new Array("boat_-_topper__spars_and_spar_fittings.html","../images/topperaccessoriesg102tmb.jpg","Boat - Topper  &#187 Spars and spar fittings","£10.95 &#187 Webbing strop boom","G10/2");
s++; item[s]=new Array("boat_-_topper__spars_and_spar_fittings.html","../images/topperaccessoriesc72tmb.jpg","Boat - Topper  &#187 Spars and spar fittings","£10.95 &#187 Webbing strop lower mast","C7/2");
s++; item[s]=new Array("boat_-_topper__spars_and_spar_fittings.html","../images/topperaccessoriesg3tmb.jpg","Boat - Topper  &#187 Spars and spar fittings","£5.45 &#187 Boom end fitting","G3");
s++; item[s]=new Array("boat_-_topper__spars_and_spar_fittings.html","../images/toppersparsk28tmb.gif","Boat - Topper  &#187 Spars and spar fittings","£8.99 &#187 Metal clew ring","TZSTA");
s++; item[s]=new Array("boat_-_topper__spars_and_spar_fittings.html","../images/toppersparsboomcleattmb.gif","Boat - Topper  &#187 Spars and spar fittings","£16.45 &#187 Boom fittings, clew, s/s cleat and eye","F/G1");
s++; item[s]=new Array("boat_-_topper__spars_and_spar_fittings.html","../images/topperlowermastfittingstmb.jpg","Boat - Topper  &#187 Spars and spar fittings","£14.25 &#187 Topper Lower Mast Fittings, eye, stop ring and cleat","F/D1");
s++; item[s]=new Array("boat_-_topper__spars_and_spar_fittings.html","../images/toppermastheadandplugtmb.jpg","Boat - Topper  &#187 Spars and spar fittings","£14.25 &#187 Topper Mast Head and Plug","F/E1");
s++; item[s]=new Array("boat_-_topper__spars_and_spar_fittings.html","../images/toppertopsectiontmb.jpg","Boat - Topper  &#187 Spars and spar fittings","£127.95 &#187 Topper Top mast section","E1");
s++; item[s]=new Array("boat_-_topper__spars_and_spar_fittings.html","../images/topperboomtmb.jpg","Boat - Topper  &#187 Spars and spar fittings","£129.95 &#187 Topper Boom","G/WR");
s++; item[s]=new Array("boat_-_topper__spars_and_spar_fittings.html","../images/topperbottomsectiontmb.jpg","Boat - Topper  &#187 Spars and spar fittings","£156.95 &#187 Topper Bottom section","D1WR");
s++; item[s]=new Array("boat_-_topper__worlds_race_pack.html","../images/topperaccessoriesw16bwtmb.jpg","Boat - Topper  &#187 Worlds race pack","£69.25 &#187 3 to 1 Kicker","W16BW");
s++; item[s]=new Array("boat_-_topper__worlds_race_pack.html","../images/topperaccessoriesw18bwtmb.jpg","Boat - Topper  &#187 Worlds race pack","£60.45 &#187 4 to 1 outhaul","W18BW");
s++; item[s]=new Array("boats_-_for_sale_supernova.html","../images/supernovatmb.jpeg","Boats - For Sale &#187 Supernova","£4,495.00 &#187 Supernova","<p>We have a supernova on site available for hire - any hire charges are refunded if a boat is purchased.Part exchange welcome please contact us for a quote.The boats are built and stored in Derby.Buyers can collect from boat builders or we can quote to deliver.</p><p>Supernova Designed for sport and leisure. &pound4495.00 including vat</p><p>This exceptional price includes a full set of sails, and is ready to sail.</p><p>Additional Accessories detailed below</p><p>&nbsp </p><table width=18% border=1> <tr> <td width=69%> <div align=center><font size=2>BOAT ACCESSORIES</font></div> </td> <td width=31%> <div align=center><font size=2>&pound</font></div> </td> </tr> <tr> <td height=15 width=69%> <p><font size=2>Padded Toe Straps </font></p> </td> <td height=15 width=31%> <div align=center><font size=2>29.99 </font></div> </td> </tr> <tr> <td width=69%><font size=2>Two Colour Hull </font></td> <td width=31%> <div align=center><font size=2>98.70 </font></div> </td> </tr> <tr> <td width=69%><font size=2>Boat Logos - Pair </font></td> <td width=31%> <div align=center><font size=2>59.60</font></div> </td> </tr> <tr> <td width=69%> <div align=center><font size=2>BOAT PROTECTION</font></div> </td> <td width=31%> <div align=center><font size=2>&pound</font></div> </td> </tr> <tr> <td width=69%> <p><font size=2>Top-Cover Flat </font></p> </td> <td width=31%> <div align=center><font size=2>149.98 </font></div> </td> </tr> <tr> <td width=69%><font size=2>Over Boom Cover </font></td> <td width=31%> <div align=center><font size=2>159.98 </font></div> </td> </tr> <tr> <td width=69%><font size=2>Under Cover </font></td> <td width=31%> <div align=center><font size=2>119.95 </font></div> </td> </tr> <tr> <td width=69%><font size=2>Combi Bag </font></td> <td width=31%> <div align=center><font size=2>59.95 </font></div> </td> </tr> <tr> <td height=19 width=69%> <div align=center><font size=2>BOAT MOVEMENT</font></div> </td> <td height=19 width=31%> <div align=center><font size=2></font></div> </td> </tr> <tr> <td width=69%><font size=2> Twin Cradle Launch Trolley </font></td> <td width=31%> <div align=center><font size=2>214.60 </font></div> </td> </tr> <tr> <td width=69%><font size=2>Comb Trailer Base </font></td> <td width=31%> <div align=center><font size=2>385.00 </font></div> </td> </tr> <tr> <td width=69%><font size=2>Comb Trailer</font></td> <td width=31%> <div align=center><font size=2>599.60 </font></div> </td> </tr> <tr> <td width=69%>&nbsp</td> <td width=31%>&nbsp</td> </tr></table><p>&nbsp</p><p>&nbsp</p>");
s++; item[s]=new Array("boats_-_for_sale_used_dinghies.html","../images/useddinghyjbphantomtmb.jpg","Boats - For Sale &#187 Used Dinghies","£2,499.00 &#187 Phantom","<p>Phantom Sail number 1047 (1992)</p><p>The boat is in good condition and ready to sail.Construction polyester foam   sandwich with wooden deck.</p><p>Included:</p><ul>  <li> Top cover</li>  <li>Bottom cover</li>  <li>Launch trolley.</li>  <li>Road Base </li>  <li>Extra set of custom foils</li></ul><p>Selling on behalf of club member – cash payment only </p><p>&nbsp </p>");
s++; item[s]=new Array("boats_-_for_sale_used_dinghies.html","../images/useddinghylaser16tmb.jpg","Boats - For Sale &#187 Used Dinghies","£2,499.00 &#187 Laser 16","<p>Laser 16 Sail number 181 (1992)</p><p>The boat is in good condition and ready to sail.</p><p>Included:</p><ul>  <li> Top cover</li>  <li>Boom cover</li> <li>Launch trolley.</li></ul><p>Selling on behalf of club member – cash payment only </p><p>&nbsp </p>");
s++; item[s]=new Array("boats_-_for_sale_used_dinghies.html","../images/useddinghysirriustmb.jpg","Boats - For Sale &#187 Used Dinghies","£2,699.00 &#187 Skipper 17","<p>Mariner 17</p><p>The boat is in good condition and ready to sail.Twin lifting keel trailer sailer   - which can be launched in 15&quot of water.</p><p>Included:</p><ul>  <li> Top cover</li>  <li>Boom cover</li>  <li>Outboard motor 3.3 hp</li>  <li>Roadbase</li></ul>");
s++; item[s]=new Array("boats_-_for_sale_used_dinghies.html","../images/useddinghyoptimistexpatttmb.jpg","Boats - For Sale &#187 Used Dinghies","£549.00 &#187 Optimist","<p>Wooden Optimist Sail No. 4594 </p><p>The boat is in good condition and ready to sail. It is ideal for a beginner   up to an intermediate sailor. </p><p>Included:</p><ul>  <li> Buoyancy bags</li>  <li>Rudder</li>  <li>Dagger board</li>  <li>Launch trolley</li>  <li>Top and bottom covers.</li></ul><p>Selling on behalf of club member – cash payment only </p>");
s++; item[s]=new Array("books_&_dvd's_books.html","../images/bookwetnotestmb.jpg","Books & Dvd's &#187 Books","£4.70 &#187 RYA Wet Notes","<p>RYA Wet Notes</p><ul> <li> Handy, pocket-sized, waterproof notebook. </li> <li>Size 105mm x 148mm. </li> <li>Lined on every other page. </li> <li>Extremely useful afloat or ashore. </li></ul>");
s++; item[s]=new Array("books_&_dvd's_books.html","../images/bookimproveyoursailingiqtmb.jpg","Books & Dvd's &#187 Books","£12.99 &#187 Improve your sailing IQ By John Driscoll","Few sailors can claim they have nothing more to learn about sailing, and this innovative book will help you sharpen your skills. No matter what your skill level, Improve Your Sailing IQ gives you the chance to dream your way through countless hours on the water. It will also help you discover just how knowledgeable you actually are about the sport. Here is valuable and simple-to-digest instruction on all aspects of sailing from one of the sport's top instructional writers. How's your sailing knowledge? Test your skills and your grasp of the theories behind them with this handy workbook. An easy question-and-answer format introduces each problem, allows you to work through it, then provides the expert answer from one of sailing's top teachers.");
s++; item[s]=new Array("books_&_dvd's_books.html","../images/bookcatamaranracingtmb.jpg","Books & Dvd's &#187 Books","£14.99 &#187 Catamaran Racing","<p>If winning cat races is your goal - look no further. You will find the winning formula here. </p><p>Catamaran Racing shows you how to improve from club level to world championship standard. You will learn how to set realistic goals, how to make your boat the fastest on the water, and how to outsail and outmanoeuvre the opposition. And every point is fully illustrated with photo sequences of the authors in action - so you can see how it's done. </p><ul> <li>Part 1 gives speed techniques - for all conditions and all points of sailing. </li> <li>Part 2 explains race tactics - how to outwit the opposition on the racecourse. </li> <li>Part 3 shows how to give your boat blinding speed. </li> <li>Part 4 demonstrates how to tune the rig, and tweak it for peak performance. </li></ul>");
s++; item[s]=new Array("books_&_dvd's_books.html","../images/bookwinninginonedesignstmb.jpg","Books & Dvd's &#187 Books","£16.99 &#187 Winning in one-designs by Dave Perry","Whether you just started racing in your local club's sunset series, or you compete seriously in a One Design fleet, this is a book you should get your hands on. It answers all those annoying little questions you always seem to forget about on race day, or feel too sheepish to ask for fear of coming off as unexperienced as you might be. Perry answers most of them quite clearly and simply. He offers a lot of advice to bring your skill along. For the beginning racer it's an awful lot to take in and much of it will be confusing, until you start racing more and see the situations arise. For anyone who is looking to make racing a part of (or a bigger part of) their life, this is a book they should have on the shelf and be ready to go back to over and over again.");
s++; item[s]=new Array("books_&_dvd's_books.html","../images/bookmantalphysicalfitnesssailingtmb.jpg","Books & Dvd's &#187 Books","£12.99 &#187 Mental and Physical fitness for sailing by Alan Beggs, John Derbyshire & John Whitmore","<p>This book describes the psychological strategies the world class sailors use to set goals, manage stress and build confidence. Part 3 contains photo sequences of sailing-specific exercises that can be used to build an individual training programme. </p><ul> <li>Set goals for confidence building and competition. </li> <li>Learn effective self-talk and straight thinking. </li> <li>Make stress work for you, not against you. </li> <li>Harness the power of visualisation. </li> <li>Learn to stay focussed so that you can cope with distractions. </li> <li>Build and maintain the on-boat relationships that really work. </li> <li>Plan your own fitness programme. </li> <li>Aerobic and Anaerobic exercises. </li> <li>Recognise the value of rest and recovery. </li> <li>Learn now to train both on the water and in the gym. </li></ul>");
s++; item[s]=new Array("books_&_dvd's_books.html","../images/bookoptimistracingtmb.jpg","Books & Dvd's &#187 Books","£12.99 &#187 Optimist Racing A manual for sailors ,parents and coaches by Phil Slater","The Optimist is the most popular children’s boat world-wide with over 250,000 sailed in 70 countries. This book is endorsed by the Optimist Association and is used by most Optimist coaches as their textbook. This second edition is fully updated and describes all the latest rigging and sailing techniques. Many Olympic gold medallists started in this class.");
s++; item[s]=new Array("books_&_dvd's_books.html","../images/bookracetrainingtmb.jpg","Books & Dvd's &#187 Books","£14.99 &#187 The RYA book of race training","Race Training: Synopsis In its third edition, this race training manual for yacht and dinghy racers takes the reader through a logical training programme to increase a racer's chances of winning. It includes exercises used by trainers and instructors at all levels, and is suitable for all ages and More... abilities.");
s++; item[s]=new Array("books_&_dvd's_books.html","../images/booksailingforkidstmb.jpg","Books & Dvd's &#187 Books","£5.99 &#187 Sailing for kids by Gary & Steve Kibble - Book","Right from the start of this entertaining guide to sailing you can see that Gary Kibble really knows what he is talking about. I found the colourful pictures and simple, explicit instructions and ideal aid to my ten year old son's passion for sailing, and really did feel that Sailing for Kids helped give him a solid and safe start in this enjoyable sport.");
s++; item[s]=new Array("books_&_dvd's_books.html","../images/booktuningyourdinghytmb.jpg","Books & Dvd's &#187 Books","£9.99 &#187 Tuning your dinghy by Lawrie Smith - BOOK","<p>Tuning your Dinghy throws a bright light on the black art of boat tuning. </p><p>Here is a logical, systematic approach to the problem of setting up your boat and fine-tuning it for maximum speed on all points of sailing. A 'troubleshooting' section at the back of the book shows how to pinpoint and cure specific weaknesses in your boat's performance. Tuning your Dinghy is part of the Sail to Win series - books by world-class sailors and sailing coaches which take a fresh look at the complex subject of racing. Each book gives the detailed expert advice that the competent sailor must have to overcome the club racer barrier and compete successfully in international fleets. The emphasis is on practical, effective advice presented in a straightforward, highly illustrated manner. </p>");
s++; item[s]=new Array("books_&_dvd's_books.html","../images/bookcrewingtowintmb.jpg","Books & Dvd's &#187 Books","£12.99 &#187 Crewing to win by Andy Hemmings - Book","<p>The crew of a racing yacht is as important as the helsman.</p><p> Indeed, if you master the techniques in this book you should be able to take your pick of boats and helmsmen. Winning begins in the mind, and Andy Hemmings first shows you how to set realistic goals and get your attitude right. He then demonstrates how to set up the boat so you can work it efficiently, and how to get it fit for the job. The bulk of the book covers the technical aspects of crewing, with each manoeuvre examined in detail and explained in words and photosequences. Finally Andy looks at the crew's responsibilities in a race and when sailing a series. This book covers all the major classes, plus the new breed of twin-wire boats with asymmetric kites. It could take you from club sailor to World Champion, and even to an Olympic medal. THE SERIES The Sail To Win books cover every aspect of competitive sailing. Written by world class sailors and coaches, they are designed to take a competent sailor through the 'club racer' barrier to compete successfully in international fleets. </p>");
s++; item[s]=new Array("books_&_dvd's_books.html","../images/bookbeyourownsailingcoachtmb.jpg","Books & Dvd's &#187 Books","£14.99 &#187 Be your own sailing coach by Jon Emmett - Book","<p>The ultimate self-learning guide to sailboat racing </p><p>In this practical self-coaching guide for the serious racing buff, veteran sailing coach Jon Emmett explains how anyone can improve his or her sailing technique in manageable stages. By breaking down racing into 20 key topics, Emmett shows how aspiring yacht and dinghy racers can learn to measure their own strengths and weaknesses and improve key skills step by step. The book also includes practical tips and wisdom from Olympic champions including Paul Goodison and Joe Glanfield. </p>");
s++; item[s]=new Array("books_&_dvd's_books.html","../images/bookrulesinpractice09012tmb.jpg","Books & Dvd's &#187 Books","£14.99 &#187 The Rules in Practice by Bryan Willis 2009 - 20012 BOOK","<p>Get ahead of the competition with this straight talking, practical guide to the racing rules</p><p> Rules in Practice is primarily for competitive sailors who race in keelboats and dinghies. </p><p>The Racing Rules of Sailing apply to all forms of sailboat racing. </p><p>The author – a member of the International Sailing Federation - looks at 100 key situations that occur on the racecourse – both championship and club racing. Unlike the competition, Bryan looks at each situation from your viewpoint, the helmsman. It summarizes what each may, must, or cannot do. Armed with this information you will have the confidence to exploit your rights to the full, on the water and in the protest room. It features a special analysis of the latest rule changes and has been extended to contain the very latest Rules and Appendices in full. </p><ul> <li>Introduction. </li> <li>1. The Basics. </li> <li>2. Before the Preparatory Signal. </li> <li>3. In the Preparatory Period. </li> <li>4. The Start. </li> <li>5. The Gate Start. </li> <li>6. On the Beat. </li> <li>7. Rounding the Windward Mark. </li> <li>8. On the Reach. </li> <li>9. Rounding the Wing Mark. </li> <li>10. Rounding the Leeward Mark from the Reach. </li> <li>11. On the Run. </li> <li>12. Rounding the leeward mark from the Run. </li> <li>13. The Finish. </li> <li>14. Means of Propulsion. </li> <li>15. Taking a Penalty. </li> <li>16. Protesting. </li> <li>17. Requesting Redress & Appealing. </li></ul>");
s++; item[s]=new Array("books_&_dvd's_dvd's.html","../images/dvdracingrulestmb.jpg","Books & Dvd's &#187 Dvd's","£29.99 &#187 Racing Rules DVD Optimist, Laser","<p>This DVD shows the most frequent situations that occur in a race and explains which are the rights and duties in each case.</p><ul> <li> The DVD combines different footage of top Optimist and Laser sailors with 2D animations. </li> <li>This plus the narration in English and Spanish of the different situations created a unique DVD! </li> <li>Using an interactive menu, the rules all around the course are covered. </li> <li>The following subjects are covered: </li> <li>Basics rules and definitions. </li> <li>Rules on the: Start, beat, top mark, reach, run, leeward mark, finish line, </li> <li>Rule 42 (Propulsion) and Rule 31 and 44 (two turns penalty) </li> <li>The DVD has 55 minutes of action with amazing footage of top sailors in Caribbean waters and excellent music background. Written by the international coach Javier Rulo Borojovich. </li></ul>");
s++; item[s]=new Array("books_&_dvd's_dvd's.html","../images/dvdryastartailingtmb.jpg","Books & Dvd's &#187 Dvd's","£9.99 &#187 RYA Start Sailing","");
s++; item[s]=new Array("books_&_dvd's_dvd's.html","../images/dvdryabettersailingtmb.jpg","Books & Dvd's &#187 Dvd's","£9.99 &#187 RYA Better sailing DVD","");
s++; item[s]=new Array("books_&_dvd's_dvd's.html","../images/dvddinghyhigherandfastertmb.jpg","Books & Dvd's &#187 Dvd's","£24.99 &#187 Higher and faster dinghy sailing dvd","");
s++; item[s]=new Array("books_&_dvd's_dvd's.html","../images/dvdstartlinecovertmb.jpg","Books & Dvd's &#187 Dvd's","£24.99 &#187 Startline DVD","<p>STARTLINE The Higher and Faster team are back! This time focusing on the most complex skill in sailboat racing: the start. </p><p>The aim of this DVD is to teach skills and techniques that will help sailors of all abilities to master the start line. Using Lasers and SB3 keelboats, Startline brings together the UK’s most talented sailors to provide an incredible insight into how to take pole position on the line. Just like previous Higher & Faster titles (Smack Down Under Higher & Faster) Startline combines in depth coaching points from elite coach Harvey Hillary with stunning on the water footage. Harvey and the Startline </p><p>Sailing Team use specific coaching tutorials to introduce the 4 zones of optimal starting: </p><ul> <li>The Line : Activate your own personal GPS so you can identify bias, slippage and time & distance to the line. </li> <li>Positioning : How to execute your 1 st beat strategy & gain a tactical advantage over other boats. </li> <li>Boat Handling : How to refine the 5 Key manoeuvres in the pre-start so that you can gain an advantage over other boats and reposition effectively. </li> <li>The Usual Suspects : The Startline Sailing Team take on explaining the complexities of the rules during the pre-start. This tutorial aims to identify who are the right of way and keep clear boats and the definition of keeping clear. The Startline Sailing Team: Harvey Hillary and Ian Clingan (Team GBR Coaches), Kevin Sproul (European Melges and Mum 30 Champion), Lizzie Vickers, Andrea Brewster, Kier Clarke and James Grant </li></ul>");
s++; item[s]=new Array("books_&_dvd's_dvd's.html","../images/dvdopticoaccdromhtmb.jpg","Books & Dvd's &#187 Dvd's","£29.50 &#187 Opticoach CDROM","");
s++; item[s]=new Array("books_&_dvd's_dvd's.html","../images/dvdadvancedoptimisthandlingtmb.jpg","Books & Dvd's &#187 Dvd's","£39.99 &#187 Advanced Optimist Boat Handling","");
s++; item[s]=new Array("cleats_clamcleat.html","../images/clamcleatcl201tmb.jpg","Cleats &#187 Clamcleat","£3.99 &#187 Clamcleat 201","Cleats for 6 - 12 mm (1/4 - 1/2) rope CL201 - Vertical With the CL201 the rope drops down into the teeth to give a quick and positive lock that is easy to release. The cleat is maufactured from UV resistant plastic, making it cost effective and ideal for holding rope in an outdoor enviroment. Its simple design has led to it being fitted on boats to farm equipment. Technical Details Length 95 mm Width 28mm Hole spacing for fixing 72mm");
s++; item[s]=new Array("cleats_clamcleat.html","../images/clamcleatcl202tmb.jpg","Cleats &#187 Clamcleat","£4.99 &#187 Clamcleat 202","Cleats for 6 - 12 mm (1/4 - 1/2) rope CL202 - Horizontal Low profile black nylon cleat. Can hold two ropes. Or a single rope can be cleated on either side. Technical Details Overall Length 79mm Width 51mm Hole spacing for fixing 79mm");
s++; item[s]=new Array("cleats_clamcleat.html","../images/clamcleatcl203tmb.jpg","Cleats &#187 Clamcleat","£1.99 &#187 Clamcleat 203","Cleats for 1 - 6 mm (1/32 - 1/4) rope CL203 - Junior One of our most popular cleats. CL203 - Black Nylon. An alloy version is also available - CL211 Mk1 Technical Details Overall Length 82mm Width 18mm Hole spacing for fixing 66mm");
s++; item[s]=new Array("cleats_clamcleat.html","../images/clamcleatcl204tmb.jpg","Cleats &#187 Clamcleat","£1.99 &#187 Clamcleat 204","CL204 - Mini An elegant design in black or white nylon. The rope drops down into the teeth. Also available in Aluminium - CL222. Overall Length 52 mm Width 17 mm Hole spacing for fixing 36 mm");
s++; item[s]=new Array("cleats_clamcleat.html","../images/clamcleatcl211mk2tmb.jpg","Cleats &#187 Clamcleat","£4.99 &#187 Clamcleat 211 MK2","Cleats for 3 - 6 mm rope CL211 MK2 - Racing Junior Mk2 neat, compact alloy cleat. Manufactured from aluminium for a light weight and durable performance.Overall Length 55mm Width 17mm Hole spacing for fixing 27mm");
s++; item[s]=new Array("cleats_clamcleat.html","../images/clamcleatcl211mk1tmb.jpg","Cleats &#187 Clamcleat","£5.50 &#187 Clamcleat 211 MK1","Cleats for 3 - 6 mm rope CL211 MK1 - Racing Junior Mk1 A very strong alloy cleat. A nylon version is also available - CL203, as well as variations with a roller fairlead - CL236 and with bottom roller - CL230. Overall Length 82mm Width 18mm Hole spacing for fixing 66mm");
s++; item[s]=new Array("cleats_clamcleat.html","../images/clamcleatcl211mk2s2tmb.jpg","Cleats &#187 Clamcleat","£5.50 &#187 Clamcleat 211 MK2 S2","Cleats for 3 - 6 mm rope CL211 MK2/S2 - Racing Junior Mk2 with Becket The becket holds the end of the rope under the cleat. No need for an extra fixing. Manufactured from aluminium for a light weight and durable performance. Overall Length 55mm Width 17mm Hole spacing for fixing 27mm");
s++; item[s]=new Array("cleats_clamcleat.html","../images/clamcleatcl217mk1tmb.jpg","Cleats &#187 Clamcleat","£5.99 &#187 Clamcleat 217 MK1","Cleats for 3 - 6 mm rope CL217 Mk1 - Side Entry Mk1 (Starboard) The side entry fairlead allows ropes to be hooked in for cleating, yet easily removed. Overall Length 82mm Width 18mm Hole spacing for fixing 66mm");
s++; item[s]=new Array("cleats_clamcleat.html","../images/clamcleatcl217mk2tmb.jpg","Cleats &#187 Clamcleat","£5.99 &#187 Clamcleat 217 MK2","Cleats for 3 - 6 mm rope CL217 Mk2 - Side Entry Mk2 (Starboard) The side entry fairlead allows ropes to be hooked in for cleating, yet easily removed. Overall Length 55mm Width 18mm Hole spacing for fixing 27mm");
s++; item[s]=new Array("cleats_clamcleat.html","../images/clamcleatcl218mk2tmb.jpg","Cleats &#187 Clamcleat","£5.50 &#187 Clamcleat 218 MK2","Cleats for 3 - 6 mm rope CL218 Mk2 - Side Entry Mk2 (Starboard) The side entry fairlead allows ropes to be hooked in for cleating, yet easily removed. Overall Length 55mm Width 17mm Hole spacing for fixing 27mm");
s++; item[s]=new Array("cleats_clamcleat.html","../images/clamcleatcl218mk1tmb.jpg","Cleats &#187 Clamcleat","£5.99 &#187 Clamcleat 218 MK1","Cleats for 3 - 6 mm rope CL218 Mk1 - Side Entry Mk1 (Port) The side entry fairlead allows ropes to be hooked in for cleating, yet easily removed. Overall Length 82mm Width 18mm Hole spacing for fixing 66mm");
s++; item[s]=new Array("cleats_clamcleat.html","../images/clamcleatcl222tmb.jpg","Cleats &#187 Clamcleat","£4.50 &#187 Clamcleat 222","Cleats for 3 - 6 mm rope CL222 - Racing Mini An elegant design in aluminium with a silver or hard anodised fiinish. The rope drops down into the teeth. An nylon version is also available - CL204. Overall Length 48mm Width 15mm Hole spacing for fixing 36mm");
s++; item[s]=new Array("cleats_clamcleat.html","../images/clamcleatcl223tmb.jpg","Cleats &#187 Clamcleat","£2.99 &#187 Clamcleat 223","Cleats for 3 - 6 mm rope Cleats rigged on a Rope CL223 - Loop Cleat A nylon cleat with a tooth design that offers a quick, positive lock that is easy to release. The side entry fairlead allows the cleat to be hooked onto the line, without threading the rope through an eye, making it ideal for tensioning volleyball nets where a quick set up is required The CL223 also makes it simple to hang fenders. It is easy to adjust so your fenders are always positioned correctly. The cleat stays on the rope so nothing gets lost. There are no moving parts and it fits all sizes of tube or wire. Lines can be rigged 1:1 or 2:1 advantage. Other uses include covers, tents & canvas structures and radio masts. Overall Length 52mm Width 18mm");
s++; item[s]=new Array("cleats_clamcleat.html","../images/clamcleatcl230tmb.jpg","Cleats &#187 Clamcleat","£6.99 &#187 Clamcleat 230","Cleats for 3 - 6 mm rope CL230 - Racing Junior MK1 with Roller The bottom roller allows ropes to enter the cleat from below. Ideal for bringing a rope through a surface. Overall Length 82mm Width 18mm Hole spacing for fixing 66mm");
s++; item[s]=new Array("cleats_clamcleat.html","../images/clamcleatcl236tmb.jpg","Cleats &#187 Clamcleat","£6.99 &#187 Clamcleat 236","Cleats for 3 - 6 mm rope CL236 - Roller Fairlead Mk1 Racing Junior The roller fairlead allows ropes to enter the cleat from above. Overall Length 82mm Width 18mm Hole spacing for fixing 66mm");
s++; item[s]=new Array("cleats_clamcleat.html","../images/clamcleatcl244tmb.jpg","Cleats &#187 Clamcleat","£7.99 &#187 Clamcleat 244","Cleats for 3 - 6 mm rope CL244 - Aluminium Boom Cleat and Clamp CL244 clamps onto a pole or tube. The high strength alloy cleat fits into the nylon clamp, which is held by 2 screws. A rubber friction packer provides a strong grip on bare nmetal poles. Three sizes of clamp are available, to fit tube diameters from 32 - 42mm (1 1/4 - 1 5/8Ø). Separate parts can be supplied for specific applications. Different thickness of rubber can be supplied to cope with tubes down to 25mm diameter. Overall Length 58mm");
s++; item[s]=new Array("cleats_clamcleat.html","../images/clamcleatcl254tmb.jpg","Cleats &#187 Clamcleat","£9.99 &#187 Clamcleat 253","Cleats for 4 - 8 mm rope Cleats rigged on a Rope CL253 - Trapeze & Vang Cleat The cleat has an in-built pulley that offers a compact solution , for rigging with a 1:1 or 2:1 advantage, where a quick, positive lock, that is easy to release is required. The Sailor's preferred choice for adjusting trapeze lines. Manufactured from aluminium for light weight and durable performance the CL253 is available in two finishes: Technical Details Overall Length 89mm Width 18mm Hole spacing for fixing 70mm");
s++; item[s]=new Array("cleats_clamcleat.html","../images/clamcleatcl257tmb.jpg","Cleats &#187 Clamcleat","£5.99 &#187 Clamcleat 254","Cleats for 4 - 8 mm rope CL254 - Racing Midi With the CL254 the rope drops down into the teeth to give a quick and positive lock that is easy to release. Will hold very high loads when used with high quality ropes. Manufactured from aluminium for light weight and durable performance the CL254 is available in two finishes: Overall Length 70mm Width 19mm Hole spacing for fixing 55mm");
s++; item[s]=new Array("cleats_clamcleat.html","../images/clamcleatcl261tmb.jpg","Cleats &#187 Clamcleat","£10.50 &#187 Clamcleat 257","Cleats for 4 - 6 mm rope CL257 - Auto-Release Racing Mini The Auto-Release cleat provides the neatest and best solution to the problem of how to lock-down a rudder blade yet allow it to flip-up if it hits the bottom or a solid obstacle in the water. The cleat holds ropes securely yet will release them immediately when the cleat is overloaded. Once tripped, it can be easily reset in seconds by just pushing the cleat back down into its base. The CL257 is also fitted with an adjustable cam so that the release tension can be set to suit the boat and local conditions. The cam is adjusted until the rudder blade is held down reliably under maximum sailing conditions. The CL257 will then be set so that the least strain is put on the rudder if it hits an obstacle. The CL257 can be fitted to virtually all lifting tillers and can also be used to protect centre boards (please view fitting instructions) Overall Length 68mm Width 24mm Hole spacing for fixing 36mm");
s++; item[s]=new Array("cleats_clamcleat.html","../images/clamcleatcl262tmb.jpg","Cleats &#187 Clamcleat","£7.99 &#187 Clamcleat 261","Cleats for 3 - 6 mm rope CL261 - Power Grip 1 Double your pulling power AND take the pain out of pulling smaller ropes. CL261 Power Grip 1 allows you to pull twice as hard, compared to using your bare hands. For right or left handed use. The smoothly contoured hand grip area has been voted the most comfortable shape to fit all hand sizes. Ideal for tensioning trampolines, halyards, boat covers as well African drums. Manufactured from high pressure die-cast aluminium for strength and durability. For two handed use try our CL262. Overall Length 95mm Width 17mm");
s++; item[s]=new Array("cleats_clamcleat.html","../images/clamcleatcl702tmb.jpg","Cleats &#187 Clamcleat","£10.99 &#187 Clamcleat 262","Cleats for 3 - 6 mm rope CL262 - Power Grip 2 Take the pain out of pulling smaller ropes. CL262 Power Grip 2 allows you to pull about 4 times as hard, compared to using your bare hands. Light, strong and convenient to carry in your pocket. The smoothly contoured hand grip area has been voted the most comfortable shape to fit all hand sizes. Manufactured from high pressure die-cast aluminium for strength and durability. Ideal for tensioning trampolines, halyards, boat covers as well African drums. For single handed use try our CL261. Overall Length 189mm Width 17mm");
s++; item[s]=new Array("cleats_clamcleat.html","../images/clamcleat268tmb.jpg","Cleats &#187 Clamcleat","£4.50 &#187 Clamcleat 268","<p>Cleats for 1 - 6 mm (1/32 - 1/4) rope CL268</p><ul> <li> Small, neat and lightweight. </li> <li>Advanced tooth technology to hold all types of small rope.</li> <li> Applications include Canoes (seat & rudder lines) </li> <li>Dinghy control lines </li> <li>Kitesurfing (5th line adjustment). </li> <li>Manufactured from aluminium for a light weight and durable performance the CL268 is available in two finishes: 1. CL268 has a silver stove enamel finish for a cost effective, high quality coating. </li></ul></html");
s++; item[s]=new Array("cleats_clamcleat.html","../images/clamcleatcl704tmb.jpg","Cleats &#187 Clamcleat","£5.99 &#187 Clamcleat 702","Cleats for 3 - 6 mm rope CL702 - Aluminium Boom Cleat The specially curved base is designed for fitting onto tubes from 29 to 32mm diameter. (1 1/8 to 1 1/4 diameter). Overall Length 82mm Width 18mm Hole spacing for fixing 66mm");
s++; item[s]=new Array("cleats_clamcleat.html","../images/clamcleatcl712tmb.jpg","Cleats &#187 Clamcleat","£5.50 &#187 Clamcleat 704","Cleats for 3 - 6 mm rope CL704 - Racing junior Mk1 with Becket The becket holds the end of the rope under the cleat. No need for an extra fixing. Manufactured from aluminium for a light weight and durable performance the CL704 is available in two finishes: CL704 has a silver stove enamel finish for a cost effective, high quality coating. Overall Length 82mm Width 18mm Hole spacing for fixing 66mm");
s++; item[s]=new Array("cleats_clamcleat.html","../images/clamcleatcl802tmb.jpg","Cleats &#187 Clamcleat","£1.99 &#187 Clamcleat 712","Cleats for 3 - 5 mm rope CL712 - Small Alloy Insert Cleat Designed to fit into a plastic moulding to combine the strength of an alloy cleat with the lower cost of a moulded component. The CL712 has the optimum tooth design for catching and holding the rope. Overall Length28mm Width 11mm");
s++; item[s]=new Array("cleats_clamcleat.html","../images/clamcleatcl803tmb.jpg","Cleats &#187 Clamcleat","£0.99 &#187 Clamcleat 802","Accessories CL802 - Tapered Pad Aids rope alignment. Tapered Pad for CL204, CL222 and CL222AN");
s++; item[s]=new Array("cleats_clamcleat.html","../images/clamcleatcl804tmb.jpg","Cleats &#187 Clamcleat","£1.25 &#187 Clamcleat 803","Accessories CL803 - Tapered Pad Aids rope alignment. Tapered pad for CL209, CL254 and CL254AN.");
s++; item[s]=new Array("cleats_clamcleat.html","../images/clamcleatcl804tmb.jpg","Cleats &#187 Clamcleat","£1.50 &#187 Clamcleat 804","Accessories CL804 - Tapered Pad Aids rope alignment. Tapered pad for CL201, CL219, CL219AN CL237 and CL238. Also makes an excellent wedge for holding a door open.");
s++; item[s]=new Array("cleats_clamcleat.html","../images/clamcleatcl814tmb.jpg","Cleats &#187 Clamcleat","£2.99 &#187 Clamcleat 814","Cleats for 3 - 6 mm rope CL814 - Keeper for CL203 & Mk1 Juniors This accessory expands the capability of conventional Clamcleat® rope cleats. The Award Winning Keeper has been designed to overcome the problem of lines being cleated accidentally as well as improving performance by holding lightly-loaded lines in the jaws of a cleat when mounted upside down. When using a cleat fitted with a Keeper, the operation and performance is completely transformed. The lead-in makes cleating a line easier and there is a satisfying and positive click as the Line is released or cleated. . These benefits mean that Clamcleat® rope cleats can now be used on control lines that are adjusted frequently. When a halyard or control line is released from a cleat fitted with a Keeper, the Keeper will stop it falling back into the cleat and re-cleating, for example when dropping a spinnaker during a race or the mainsail when unrigging ashore. A patent has been applied for the innovative Keeper. Overall Length 82mm Width 24mm Hole spacing for fixing 66mm");
s++; item[s]=new Array("cleats_clamcleat.html","../images/clamcleatcl816tmb.jpg","Cleats &#187 Clamcleat","£7.99 &#187 Clamcleat 816","Cleats for 3 - 6 mm rope CL816 - Cage for CL814 The Cage is an accessory that allows ropes to be cleated and uncleated at an angle of up to 70 degrees, rather than only in line with the cleat. Adding Cages to cleats fitted with Keepers will allow the helmsman or crew to adjust a control line from different positions quickly, easily, positively and without fear of accidental cleating. Simply pull the rope back at an angle and it is guided down into the teeth, as shown in the sketches below. The stainless steel rear fairlead provides a long life under racing conditions. Overall Length 88mm Width 28mm Hole spacing for fixing 66mm");
s++; item[s]=new Array("cleats_clamcleat.html","../images/clamcleatcl817tmb.jpg","Cleats &#187 Clamcleat","£6.99 &#187 Clamcleat 817","Cleats for 3 - 6 mm rope The Cage is an accessory that allows ropes to be cleated and uncleated at an angle of up to 70 degrees, rather than only in line with the cleat. CL817 - Cage for CL815 The Cage is an accessory that allows ropes to be cleated and uncleated at an angle of up to 70 degrees, rather than only in line with the cleat. Adding Cages to cleats fitted with Keepers will allow the helmsman or crew to adjust a control line from different positions quickly, easily, positively and without fear of accidental cleating. Simply pull the rope back at an angle and it is guided down into the teeth, as shown in the sketches below. The stainless steel rear fairlead provides a long life under racing conditions. Overall Length 61mm Width 27mm Hole spacing for fixing 27mm");
s++; item[s]=new Array("cleats_clamcleat.html","../images/clamcleatcl818tmb.jpg","Cleats &#187 Clamcleat","£1.70 &#187 Clamcleat 818","Cleats for 3 - 6 mm rope Tapered Pad allows correct rope/cleating alignment. Can be mounted either way round. Backplate provides under deck support when bolting through thin sections and is supplied with every pad. For CL203, CL211 Mk1, CL217 Mk1, CL218 Mk1, CL236, CL704 plus hard anodised versions. Overall Length 87mm Width 27mm");
s++; item[s]=new Array("cleats_clamcleat.html","../images/clamcleatcl819tmb.jpg","Cleats &#187 Clamcleat","£1.60 &#187 Clamcleat 819","Cleats for 3 - 6 mm rope CL819 - Tapered Pad Tapered Pad allows correct rope/cleating alignment. Can be mounted either way round. Backplate provides under deck support when bolting through thin sections and is supplied with every pad. For CL211 Mk2, CL211MK2 S2, CL217 Mk2, CL218 Mk2 plus hard anodised versions. Overall Length 59mm Width 22mm");
s++; item[s]=new Array("cleats_harken.html","../images/harken297tmb.jpg","Cleats &#187 harken","£2.99 &#187 harken 297 cam wedge kit","Fits 338 and 423");
s++; item[s]=new Array("cleats_harken.html","../images/harken425gtmb.jpg","Cleats &#187 harken","£3.50 &#187 harken 425 Cam cleat accessories Fair lead","Fits 338 and 423 cam cleats. Available in red green and black");
s++; item[s]=new Array("cleats_harken.html","../images/harken145tmb.jpg","Cleats &#187 harken","£3.99 &#187 harken 145 Cam wedge kit","Fits 150 and 365");
s++; item[s]=new Array("cleats_harken.html","../images/harken425gtmb.jpg","Cleats &#187 harken","£4.50 &#187 harken 424 Cam cleat accessories Fair lead","Fits 365 cam cleats.Available in red green and black.");
s++; item[s]=new Array("cleats_harken.html","../images/harken294tmb.jpg","Cleats &#187 harken","£4.99 &#187 harken 294 15 degree Angled cam riser","Fits 338 and 423");
s++; item[s]=new Array("cleats_harken.html","../images/harken295tmb.jpg","Cleats &#187 harken","£5.50 &#187 harken 295 Flat cam riser","Fits 150 and 365");
s++; item[s]=new Array("cleats_harken.html","../images/harken329tmb.jpg","Cleats &#187 harken","£8.50 &#187 harken 329 Cam cleat accessories Fair lead","Fits 338 and 423 cam cleats");
s++; item[s]=new Array("cleats_harken.html","../images/harken328tmb.jpg","Cleats &#187 harken","£9.50 &#187 harken 328 Cam cleat accessories Fair lead","Fits 150 and 365 cam cleats");
s++; item[s]=new Array("cleats_harken.html","../images/harken375tmb.jpg","Cleats &#187 harken","£9.99 &#187 harken 372 Cam cleat accessories Fair lead","Xtreme angle cam that fits 338 and 423 Please this item comes as fairlead does not include cam cleat shown in picture.");
s++; item[s]=new Array("cleats_harken.html","../images/harken375tmb.jpg","Cleats &#187 harken","£11.50 &#187 harken 375 Cam cleat accessories Fair lead","Xtreme angle cam that fits 150 Please this item comes as fairlead does not include 150 cam cleat shown in picture.");
s++; item[s]=new Array("cleats_harken.html","../images/harken365tmb.jpg","Cleats &#187 harken","£19.99 &#187 harken 365 Carbo cam","Height 28mm Length 65mm Width 32mm Fastener spacing 38mm Pawls plastic carbon matrix");
s++; item[s]=new Array("cleats_harken.html","../images/harken338tmb.jpg","Cleats &#187 harken","£20.50 &#187 harken 338 micro cam-matic","Height 20mm Length 48mm Width 24mm Fastener spacing 27mm Pawls Aluminium");
s++; item[s]=new Array("cleats_harken.html","../images/harken150tmb.jpg","Cleats &#187 harken","£26.84 &#187 harken 150 cam matic - standard","Height 30mm Length 65mm Width 32mm Fastener spacing 38mm Pawls Aluminium");
s++; item[s]=new Array("cleats_harken.html","../images/harken280tmb.jpg","Cleats &#187 harken","£40.99 &#187 harken 280","Height 32mm Length 85mm Width 38 Fastener spacing 52mm Pawls Aluminium");
s++; item[s]=new Array("cleats_ronstan.html","../images/rf5003tmb.jpg","Cleats &#187 ronstan","£3.25 &#187 ronstan rf5003","Saddle, flared top, suits small C-Cleat and T-Cleat");
s++; item[s]=new Array("cleats_ronstan.html","../images/rf5002tmb.jpg","Cleats &#187 ronstan","£3.99 &#187 ronstan rf5002","Wedge kit, suits small C-Cleat and T-Cleat");
s++; item[s]=new Array("cleats_ronstan.html","../images/rf5012tmb.jpg","Cleats &#187 ronstan","£3.99 &#187 ronstan rf5012","Wedge kit, suits medium C-Cleat and T-Cleat");
s++; item[s]=new Array("cleats_ronstan.html","../images/rf5013tmb.jpg","Cleats &#187 ronstan","£3.99 &#187 ronstan rf5013","Saddle, flared top, suits medium C-Cleat and T-Cleat");
s++; item[s]=new Array("cleats_ronstan.html","../images/rf5004tmb.jpg","Cleats &#187 ronstan","£4.67 &#187 ronstan rf5004","Rope guide, suits small C-Cleat and T-Cleat");
s++; item[s]=new Array("cleats_ronstan.html","../images/rf5005tmb.jpg","Cleats &#187 ronstan","£4.82 &#187 ronstan rf5005","Front mounted fairlead, suits small C-Cleat and T-Cleat");
s++; item[s]=new Array("cleats_ronstan.html","../images/rf5213tmb.jpg","Cleats &#187 ronstan","£4.99 &#187 ronstan rf5213","Saddle, stainless steel liner, black");
s++; item[s]=new Array("cleats_ronstan.html","../images/rf5016tmb.jpg","Cleats &#187 ronstan","£5.25 &#187 ronstan rf5016","Riser/curved surface adapter, suits medium C-Cleat and T-Cleat");
s++; item[s]=new Array("cleats_ronstan.html","../images/rf5015tmb.jpg","Cleats &#187 ronstan","£5.74 &#187 ronstan rf5015","Front mounted fairlead, suits medium C-Cleat and T-Cleat");
s++; item[s]=new Array("cleats_ronstan.html","../images/rf5014tmb.jpg","Cleats &#187 ronstan","£5.99 &#187 ronstan rf5014","Rope guide, suits medium C-Cleat and T-Cleat");
s++; item[s]=new Array("cleats_ronstan.html","../images/rf5217tmb.jpg","Cleats &#187 ronstan","£7.50 &#187 ronstan rf5217","Heavy duty front mounted fairlead");
s++; item[s]=new Array("cleats_ronstan.html","../images/rf5000tmb.jpg","Cleats &#187 ronstan","£16.50 &#187 ronstan rf5000","Carbon Fibre C-Cleat Cam Cleat Small");
s++; item[s]=new Array("cleats_ronstan.html","../images/rf5000tmb.jpg","Cleats &#187 ronstan","£21.50 &#187 ronstan rf5010","Carbon Fibre C-Cleat Cam Cleat Medium");
s++; item[s]=new Array("cleats_ronstan.html","../images/rf5020tmb.jpg","Cleats &#187 ronstan","£38.50 &#187 ronstan rf5020","Carbon Fibre C-Cleat Cam Cleat Large");
s++; item[s]=new Array("cleats_-_spinlock_spinlock.html","../images/spinlockpxr0206tmb.jpg","Cleats - Spinlock &#187 Spinlock","£24.99 &#187 Spinlock PXR0206","<p>New PXR Cam Cleat designed for precision control of high performance lines 2-6mm The PXR racing camcleat features a three stage adjustment spring allowing users to select the release setting for the application and prevailing conditions. Lighter settings for continuously trimmed sheets, traveller controls, vangs and similar controls. Harder for halyards and occasionally adjusted lines. The roller action of the PXR ensures easy release of lines as wind load increases.</p><p>Features and benefits</p><ul> <li>Three stage adjustable release spring </li> <li>Alloy cam and base surfaces as standard</li> <li> Large grip areakinder to rope </li> <li>Ultra compact low profile design </li> <li>Stainless steel rope guides provide wide operating arc </li> <li>Integral 6 degree wedge </li> <li>T-Series for retrofit in hole centres of traditional cam cleats</li> <li> SW-Series swivel mounted </li> <li>PXR VP-Series mast mounted PXR </li></ul>");
s++; item[s]=new Array("cleats_-_spinlock_spinlock.html","../images/spinlockpxr0206swtmb.jpg","Cleats - Spinlock &#187 Spinlock","£37.99 &#187 Spinlock PXR0206/SW","<p>Swivel base new PXR Cam Cleat designed for 360 degee precision control of high performance lines 2-6mm The PXR0206/SW is ideal for single cleat control of centre jib sheets and dinghy vangs in the 2-6mm rope range. The PXR racing camcleat features a three stage adjustment spring allowing users to select the release setting for the application and prevailing conditions. Lighter settings for continuously trimmed sheets, traveller controls, vangs and similar controls. Harder for halyards and occasionally adjusted lines. The roller action of the PXR ensures easy release of lines as wind load increases </p><p>Features and benefits</p><p>&nbsp</p><ul> <li>360 degree control </li> <li>Identical footprint to traditional swivel cleats PXR0810/SW also available </li> <li>Three stage adjustable release spring </li> <li>Alloy cam and base surfaces as standard </li> <li>Large grip areakinder to rope </li> <li>Ultra compact low profile design </li> <li>Stainless steel rope guides provide wide operating arc </li> <li>Integral 6 degree wedge </li> <li>T-Series for retrofit in hole centres of traditional cam cleats </li> <li>VP-Series mast mounted PXR </li></ul>");
s++; item[s]=new Array("compasses_plastimo.html","../images/plastimocompassiris100tmb.jpeg","Compasses &#187 Plastimo","£66.99 &#187 Plastimo compass iris 100","Universal compass. Can be installed on any inclination or position : vertical, horizontal, laying flat, upside down - Conical card with double reading (direct and horizontal) - Gimballed magnetic set : the card remains perfectly horizontal, whatever the angle of the compass installation - 2 mobile lubber lines -Pivot and hard - Floats - Weight : 295 grammes - Complies with French Decree of 23 November 1987 - Comes complete with protection padded pouch, bracket and assembly screws. 5 year warranty");
s++; item[s]=new Array("compasses_silva.html","../images/silvacompassfield7tmb.jpeg","Compasses &#187 Silva","£9.99 &#187 Silva compass Field 7","The new contemporary version of the well known favourite that is probably the world's best selling compass. A soft, easy to grip, compass housing is made from Dryflex, chosen for best performance and a positive tactile feeling. The small size and the rounded back of the base plate makes this compass an ideal youth/beginners compass for all kind of land navigation. Map measuring scales mm, 1:50k and 1:25k. Declination scale inside the capsule.");
s++; item[s]=new Array("compasses_silva.html","../images/silvacompassranger3tmb.jpeg","Compasses &#187 Silva","£12.99 &#187 Silva compass ranger 3","This series is specially suited for more experienced users such as backpackers, mountaineers, hunters, fishermen etc. All RANGER compasses are equipped with the patented red/black north/south lines in the capsule for quick and correct course setting, north indicator on the red end of the compass needle and luminous markings for navigation in the dark.");
s++; item[s]=new Array("compasses_silva.html","../images/silvacompass73rtmb.jpeg","Compasses &#187 Silva","£79.95 &#187 Silva compass 73r","73R is the perfect combination compass. It can be installed in any inclination or position with a bracket that allows for fast and easy removal. The handle makes it useful as a sighting compass simply remove the compass from its bracket and sight the mark to determine the bearing. Tactical compass scale on the vertical part of the card. 73R is also easy to remove from bracket for security purposes.");
s++; item[s]=new Array("compasses_silva.html","../images/silvacompass103rtmb.jpeg","Compasses &#187 Silva","£119.95 &#187 Silva compass 103r","103R is the world's most popular racing compass for dinghies. First developed for the Laser, it has become a firm favourite across many dinghy classes.");
s++; item[s]=new Array("compasses_silva.html","../images/silvacompass103petmb.jpeg","Compasses &#187 Silva","£127.50 &#187 Silva compass 103PE","103PE designed for bulkhead-mount.");
s++; item[s]=new Array("fastenings_eyelet_kits.html","../images/dinghyfasteningshipkisseyeletkitpp22pp20tmb.jpg","Fastenings &#187 Eyelet kits","£5.99 &#187 Brass eyelet kits","<p>BRASS EYELET KIT</p><ul> <li>Hipkiss Eyelet Kit PP20 Each kit contains 50 eyelets rings and a punch and die set. Internal diameter of eyelets is 6.75mm</li> <li>Hipkiss Eyelet Kit PP22 Each kit contains 25 eyelets rings and a punch and die set.Internal diameter of eyelet is 7.94mm</li></ul><p>&nbsp</p>");
s++; item[s]=new Array("fastenings_eyelet_kits.html","../images/dinghyfasteningshipkisseyeletkitpp28pp26tmb.jpg","Fastenings &#187 Eyelet kits","£9.99 &#187 Brass eyelet kits","<p>BRASS EYELET KIT</p><ul> <li>Hipkiss Eyelet Kit PP26 Each kit contains 25 eyelets rings and a punch and die set. Internal diameter of eyelets is 11.11mm</li> <li>Hipkiss Eyelet Kit PP22 Each kit contains 15 eyelets rings and a punch and die set.Internal diameter of eyelet is 12.7mm</li></ul><p>&nbsp</p>");
s++; item[s]=new Array("fastenings_rivets.html","../images/dinghyfasteningsmonelrivettmb.jpg","Fastenings &#187 Rivets","£2.40 &#187 Monel rivets 3mm diameter","Packs of 6");
s++; item[s]=new Array("fastenings_rivets.html","../images/dinghyfasteningsmonelrivettmb.jpg","Fastenings &#187 Rivets","£2.40 &#187 Monel rivets 4mm diameter","Packs of 6");
s++; item[s]=new Array("fastenings_rivets.html","../images/dinghyfasteningsmonelrivettmb.jpg","Fastenings &#187 Rivets","£3.20 &#187 Monel rivets 5mm diameter","Packs of 5");
s++; item[s]=new Array("fastenings_rivets.html","../images/dinghyfasteningsmonelrivettmb.jpg","Fastenings &#187 Rivets","£4.50 &#187 Monel rivets 5mm diameter","Packs of 5");
s++; item[s]=new Array("fastenings_-_bolts_machine_counter_sunk.html","../images/dinghyfasteningscskmachinescrewtmb.jpg","Fastenings - bolts machine &#187 Counter sunk","£1.60 &#187 M3 slot counter sunk machine bolts stainless steel grade A4","pack of 4 complete with nuts and washers.<p>&nbsp</p><ul> <li>These fixings are A4 stainless steel.It has a far greater resistance to saltwater corrosion. A4 is the stainless steel grade normally required for saltwater");
s++; item[s]=new Array("fastenings_-_bolts_machine_counter_sunk.html","../images/dinghyfasteningscskmachinescrewtmb.jpg","Fastenings - bolts machine &#187 Counter sunk","£1.60 &#187 M4slot counter sunk machine bolts stainless steel grade A4","pack of 4 complete with nuts and washers.<p>&nbsp</p><ul> <li>These fixings are A4 stainless steel.It has a far greater resistance to saltwater corrosion. A4 is the stainless steel grade normally required for saltwater");
s++; item[s]=new Array("fastenings_-_bolts_machine_counter_sunk.html","../images/dinghyfasteningscskmachinescrewtmb.jpg","Fastenings - bolts machine &#187 Counter sunk","£2.35 &#187 M4 slot counter sunk machine bolts stainless steel grade A4","pack of 4 complete with nuts and washers.<p>&nbsp</p><ul> <li>These fixings are A4 stainless steel.It has a far greater resistance to saltwater corrosion. A4 is the stainless steel grade normally required for saltwater");
s++; item[s]=new Array("fastenings_-_bolts_machine_counter_sunk.html","../images/dinghyfasteningscskmachinescrewtmb.jpg","Fastenings - bolts machine &#187 Counter sunk","£1.60 &#187 M5 slot counter sunk machine bolts stainless steel grade A4","pack of 4 complete with nuts and washers.<p>&nbsp</p><ul> <li>These fixings are A4 stainless steel.It has a far greater resistance to saltwater corrosion. A4 is the stainless steel grade normally required for saltwater");
s++; item[s]=new Array("fastenings_-_bolts_machine_counter_sunk.html","../images/dinghyfasteningscskmachinescrewtmb.jpg","Fastenings - bolts machine &#187 Counter sunk","£2.35 &#187 M5 slot counter sunk machine bolts stainless steel grade A4","pack of 4 complete with nuts and washers.<p>&nbsp</p><ul> <li>These fixings are A4 stainless steel.It has a far greater resistance to saltwater corrosion. A4 is the stainless steel grade normally required for saltwater");
s++; item[s]=new Array("fastenings_-_bolts_machine_counter_sunk.html","../images/dinghyfasteningscskmachinescrewtmb.jpg","Fastenings - bolts machine &#187 Counter sunk","£2.35 &#187 M5 slot counter sunk machine bolts stainless steel grade A4","pack of 1 complete with nut and washer.<p>&nbsp</p><ul> <li>These fixings are A4 stainless steel.It has a far greater resistance to saltwater corrosion. A4 is the stainless steel grade normally required for saltwater");
s++; item[s]=new Array("fastenings_-_bolts_machine_counter_sunk.html","../images/dinghyfasteningscskmachinescrewtmb.jpg","Fastenings - bolts machine &#187 Counter sunk","£2.35 &#187 M6 slot counter sunk machine bolts stainless steel grade A4","pack of 4 complete with nuts and washers.<p>&nbsp</p><ul> <li>These fixings are A4 stainless steel.It has a far greater resistance to saltwater corrosion. A4 is the stainless steel grade normally required for saltwater");
s++; item[s]=new Array("fastenings_-_bolts_machine_counter_sunk.html","../images/dinghyfasteningscskmachinescrewtmb.jpg","Fastenings - bolts machine &#187 Counter sunk","£2.35 &#187 M6 slot counter sunk machine bolts stainless steel grade A4","pack of 1 complete with nut and washer.<p>&nbsp</p><ul> <li>These fixings are A4 stainless steel.It has a far greater resistance to saltwater corrosion. A4 is the stainless steel grade normally required for saltwater applications. </li></ul>");
s++; item[s]=new Array("fastenings_-_bolts_machine_pan_head.html","../images/dinghyfasteningspanmachinescrewtmb.jpg","Fastenings - bolts machine &#187 Pan head","£1.60 &#187 M3 slot pan head machine bolts stainless steel grade A4","pack of 4 complete with nuts and washers.<p>&nbsp</p><ul> <li>These fixings are A4 stainless steel.It has a far greater resistance to saltwater corrosion. A4 is the stainless steel grade normally required for saltwater");
s++; item[s]=new Array("fastenings_-_bolts_machine_pan_head.html","../images/dinghyfasteningspanmachinescrewtmb.jpg","Fastenings - bolts machine &#187 Pan head","£1.60 &#187 M4slot pan head machine bolts stainless steel grade A4","pack of 4 complete with nuts and washers.<p>&nbsp</p><ul> <li>These fixings are A4 stainless steel.It has a far greater resistance to saltwater corrosion. A4 is the stainless steel grade normally required for saltwater applications. </li></ul>");
s++; item[s]=new Array("fastenings_-_bolts_machine_pan_head.html","../images/dinghyfasteningspanmachinescrewtmb.jpg","Fastenings - bolts machine &#187 Pan head","£2.35 &#187 M4 slot pan head machine bolts stainless steel grade A4","pack of 4 complete with nuts and washers.<p>&nbsp</p><ul> <li>These fixings are A4 stainless steel.It has a far greater resistance to saltwater corrosion. A4 is the stainless steel grade normally required for saltwater applications. </li></ul>");
s++; item[s]=new Array("fastenings_-_bolts_machine_pan_head.html","../images/dinghyfasteningspanmachinescrewtmb.jpg","Fastenings - bolts machine &#187 Pan head","£1.60 &#187 M5 slot pan head machine bolts stainless steel grade A4","pack of 4 complete with nuts and washers.<p>&nbsp</p><ul> <li>These fixings are A4 stainless steel.It has a far greater resistance to saltwater corrosion. A4 is the stainless steel grade normally required for saltwater");
s++; item[s]=new Array("fastenings_-_bolts_machine_pan_head.html","../images/dinghyfasteningspanmachinescrewtmb.jpg","Fastenings - bolts machine &#187 Pan head","£2.35 &#187 M5 slot pan head machine bolts stainless steel grade A4","pack of 4 complete with nuts and washers.<p>&nbsp</p><ul> <li>These fixings are A4 stainless steel.It has a far greater resistance to saltwater corrosion. A4 is the stainless steel grade normally required for saltwater");
s++; item[s]=new Array("fastenings_-_bolts_machine_pan_head.html","../images/dinghyfasteningspanmachinescrewtmb.jpg","Fastenings - bolts machine &#187 Pan head","£2.35 &#187 M5 slot pan head machine bolts stainless steel grade A4","pack of 1 complete with nut and washer.<p>&nbsp</p><ul> <li>These fixings are A4 stainless steel.It has a far greater resistance to saltwater corrosion. A4 is the stainless steel grade normally required for saltwater applications. </li></ul>");
s++; item[s]=new Array("fastenings_-_bolts_machine_pan_head.html","../images/dinghyfasteningspanmachinescrewtmb.jpg","Fastenings - bolts machine &#187 Pan head","£2.35 &#187 M6 slot pan head machine bolts stainless steel grade A4","pack of 4 complete with nuts and washers.<p>&nbsp</p><ul> <li>These fixings are A4 stainless steel.It has a far greater resistance to saltwater corrosion. A4 is the stainless steel grade normally required for saltwater");
s++; item[s]=new Array("fastenings_-_bolts_machine_pan_head.html","../images/dinghyfasteningspanmachinescrewtmb.jpg","Fastenings - bolts machine &#187 Pan head","£2.35 &#187 M6 slot pan head machine bolts stainless steel grade A4","pack of 1 complete with nut and washer.<p>&nbsp</p><ul> <li>These fixings are A4 stainless steel.It has a far greater resistance to saltwater corrosion. A4 is the stainless steel grade normally required for saltwater applications. </li></ul>");
s++; item[s]=new Array("fastenings_-_bolts_self_tapping_counter_sunk.html","../images/dinghyfasteningscskselftappingscrewtmb.jpg","Fastenings - bolts self tapping &#187 Counter sunk","£1.60 &#187 2.9mm diameter slot head countersunk self tapping screws - stainless steel grade A4","pack of 15 .<p>&nbsp</p><ul> <li>These fixings are A4 stainless steel.It has a far greater resistance to saltwater corrosion. A4 is the stainless steel grade normally required for saltwater applications. </li></ul>");
s++; item[s]=new Array("fastenings_-_bolts_self_tapping_counter_sunk.html","../images/dinghyfasteningscskselftappingscrewtmb.jpg","Fastenings - bolts self tapping &#187 Counter sunk","£1.60 &#187 3.5mm diameter slot head countersunk self tapping screws - stainless steel grade A4","pack of 15 .<p>&nbsp</p><ul> <li>These fixings are A4 stainless steel.It has a far greater resistance to saltwater corrosion. A4 is the stainless steel grade normally required for saltwater applications. </li></ul>");
s++; item[s]=new Array("fastenings_-_bolts_self_tapping_counter_sunk.html","../images/dinghyfasteningscskselftappingscrewtmb.jpg","Fastenings - bolts self tapping &#187 Counter sunk","£1.60 &#187 3.5mm diameter slot head countersunk self tapping screws - stainless steel grade A4","pack of 10 .<p>&nbsp</p><ul> <li>These fixings are A4 stainless steel.It has a far greater resistance to saltwater corrosion. A4 is the stainless steel grade normally required for saltwater applications. </li></ul>");
s++; item[s]=new Array("fastenings_-_bolts_self_tapping_counter_sunk.html","../images/dinghyfasteningscskselftappingscrewtmb.jpg","Fastenings - bolts self tapping &#187 Counter sunk","£1.60 &#187 4.2mm diameter slot head countersunk self tapping screws - stainless steel grade A4","pack of 10 .<p>&nbsp</p><ul> <li>These fixings are A4 stainless steel.It has a far greater resistance to saltwater corrosion. A4 is the stainless steel grade normally required for saltwater applications. </li></ul>");
s++; item[s]=new Array("fastenings_-_bolts_self_tapping_counter_sunk.html","../images/dinghyfasteningscskselftappingscrewtmb.jpg","Fastenings - bolts self tapping &#187 Counter sunk","£2.35 &#187 4.2mm diameter slot head countersunk self tapping screws - stainless steel grade A4","pack of 10 .<p>&nbsp</p><ul> <li>These fixings are A4 stainless steel.It has a far greater resistance to saltwater corrosion. A4 is the stainless steel grade normally required for saltwater applications. </li></ul>");
s++; item[s]=new Array("fastenings_-_bolts_self_tapping_counter_sunk.html","../images/dinghyfasteningscskselftappingscrewtmb.jpg","Fastenings - bolts self tapping &#187 Counter sunk","£1.70 &#187 4.8mm diameter slot head countersunk self tapping screws - stainless steel grade A4","13mm come in packs of 10, 19 and 25mm pack of 6 .<p>&nbsp</p><ul> <li>These fixings are A4 stainless steel.It has a far greater resistance to saltwater corrosion. A4 is the stainless steel grade normally required for saltwater applications. </li></ul>");
s++; item[s]=new Array("fastenings_-_bolts_self_tapping_counter_sunk.html","../images/dinghyfasteningscskselftappingscrewtmb.jpg","Fastenings - bolts self tapping &#187 Counter sunk","£1.70 &#187 4.8mm diameter slot head countersunk self tapping screws - stainless steel grade A4","packs of 6<p>&nbsp</p><ul> <li>These fixings are A4 stainless steel.It has a far greater resistance to saltwater corrosion. A4 is the stainless steel grade normally required for saltwater applications. </li></ul>");
s++; item[s]=new Array("fastenings_-_bolts_self_tapping_counter_sunk.html","../images/dinghyfasteningscskselftappingscrewtmb.jpg","Fastenings - bolts self tapping &#187 Counter sunk","£1.70 &#187 5.5mm diameter slot head countersunk self tapping screws - stainless steel grade A4","packs of 6<p>&nbsp</p><ul> <li>These fixings are A4 stainless steel.It has a far greater resistance to saltwater corrosion. A4 is the stainless steel grade normally required for saltwater applications. </li></ul>");
s++; item[s]=new Array("fastenings_-_bolts_self_tapping_counter_sunk.html","../images/dinghyfasteningscskselftappingscrewtmb.jpg","Fastenings - bolts self tapping &#187 Counter sunk","£1.70 &#187 5.5mm diameter slot head countersunk self tapping screws - stainless steel grade A4","packs of 4<p>&nbsp</p><ul> <li>These fixings are A4 stainless steel.It has a far greater resistance to saltwater corrosion. A4 is the stainless steel grade normally required for saltwater applications. </li></ul>");
s++; item[s]=new Array("fastenings_-_bolts_self_tapping_pan_head.html","../images/dinghyfasteningspanselftappingscrewtmb.jpg","Fastenings - bolts self tapping &#187 Pan head","£1.60 &#187 2.9mm diameter slot head pan head self tapping screws - stainless steel grade A4","pack of 15 .<p>&nbsp</p><ul> <li>These fixings are A4 stainless steel.It has a far greater resistance to saltwater corrosion. A4 is the stainless steel grade normally required for saltwater applications. </li></ul>");
s++; item[s]=new Array("fastenings_-_bolts_self_tapping_pan_head.html","../images/dinghyfasteningspanselftappingscrewtmb.jpg","Fastenings - bolts self tapping &#187 Pan head","£1.60 &#187 3.5mm diameter slot head pan head self tapping screws - stainless steel grade A4","pack of 15 .<p>&nbsp</p><ul> <li>These fixings are A4 stainless steel.It has a far greater resistance to saltwater corrosion. A4 is the stainless steel grade normally required for saltwater applications. </li></ul>");
s++; item[s]=new Array("fastenings_-_bolts_self_tapping_pan_head.html","../images/dinghyfasteningspanselftappingscrewtmb.jpg","Fastenings - bolts self tapping &#187 Pan head","£1.60 &#187 3.5mm diameter slot head pan head self tapping screws - stainless steel grade A4","pack of 10 .<p>&nbsp</p><ul> <li>These fixings are A4 stainless steel.It has a far greater resistance to saltwater corrosion. A4 is the stainless steel grade normally required for saltwater applications. </li></ul>");
s++; item[s]=new Array("fastenings_-_bolts_self_tapping_pan_head.html","../images/dinghyfasteningspanselftappingscrewtmb.jpg","Fastenings - bolts self tapping &#187 Pan head","£1.60 &#187 4.2mm diameter slot head pan head self tapping screws - stainless steel grade A4","pack of 10 .<p>&nbsp</p><ul> <li>These fixings are A4 stainless steel.It has a far greater resistance to saltwater corrosion. A4 is the stainless steel grade normally required for saltwater applications. </li></ul>");
s++; item[s]=new Array("fastenings_-_bolts_self_tapping_pan_head.html","../images/dinghyfasteningspanselftappingscrewtmb.jpg","Fastenings - bolts self tapping &#187 Pan head","£2.35 &#187 4.2mm diameter slot head pan head self tapping screws - stainless steel grade A4","pack of 10 .<p>&nbsp</p><ul> <li>These fixings are A4 stainless steel.It has a far greater resistance to saltwater corrosion. A4 is the stainless steel grade normally required for saltwater applications. </li></ul>");
s++; item[s]=new Array("fastenings_-_bolts_self_tapping_pan_head.html","../images/dinghyfasteningspanselftappingscrewtmb.jpg","Fastenings - bolts self tapping &#187 Pan head","£1.70 &#187 4.8mm diameter slot head pan head self tapping screws - stainless steel grade A4","13mm come in packs of 10, 19 and 25mm pack of 6 .<p>&nbsp</p><ul> <li>These fixings are A4 stainless steel.It has a far greater resistance to saltwater corrosion. A4 is the stainless steel grade normally required for saltwater applications. </li></ul>");
s++; item[s]=new Array("fastenings_-_bolts_self_tapping_pan_head.html","../images/dinghyfasteningspanselftappingscrewtmb.jpg","Fastenings - bolts self tapping &#187 Pan head","£1.70 &#187 4.8mm diameter slot head pan head self tapping screws - stainless steel grade A4","packs of 6<p>&nbsp</p><ul> <li>These fixings are A4 stainless steel.It has a far greater resistance to saltwater corrosion. A4 is the stainless steel grade normally required for saltwater applications. </li></ul>");
s++; item[s]=new Array("fastenings_-_bolts_self_tapping_pan_head.html","../images/dinghyfasteningspanselftappingscrewtmb.jpg","Fastenings - bolts self tapping &#187 Pan head","£1.70 &#187 5.5mm diameter slot head pan head self tapping screws - stainless steel grade A4","packs of 6<p>&nbsp</p><ul> <li>These fixings are A4 stainless steel.It has a far greater resistance to saltwater corrosion. A4 is the stainless steel grade normally required for saltwater applications. </li></ul>");
s++; item[s]=new Array("fastenings_-_bolts_self_tapping_pan_head.html","../images/dinghyfasteningspanselftappingscrewtmb.jpg","Fastenings - bolts self tapping &#187 Pan head","£1.70 &#187 5.5mm diameter slot head pan head self tapping screws - stainless steel grade A4","packs of 4<p>&nbsp</p><ul> <li>These fixings are A4 stainless steel.It has a far greater resistance to saltwater corrosion. A4 is the stainless steel grade normally required for saltwater applications. </li></ul>");
s++; item[s]=new Array("fastenings_-_nuts_washers_nyloc_nuts.html","../images/dinghyfasteningsnylocnuttmb.jpg","Fastenings - nuts washers &#187 Nyloc nuts","£1.00 &#187 Nyloc nuts stainless steel grade A4","Pack of 2.<p>&nbsp</p><ul> <li>These fixings are A4 stainless steel.It has a far greater resistance to saltwater corrosion. A4 is the stainless steel grade normally required for saltwater applications. </li></ul>");
s++; item[s]=new Array("fastenings_-_nuts_washers_nyloc_nuts.html","../images/dinghyfasteningsnylocnuttmb.jpg","Fastenings - nuts washers &#187 Nyloc nuts","£1.20 &#187 Nyloc nuts stainless steel grade A4","Pack of 2.<p>&nbsp</p><ul> <li>These fixings are A4 stainless steel.It has a far greater resistance to saltwater corrosion. A4 is the stainless steel grade normally required for saltwater applications. </li></ul>");
s++; item[s]=new Array("fastenings_-_nuts_washers_nyloc_nuts.html","../images/dinghyfasteningsnylocnuttmb.jpg","Fastenings - nuts washers &#187 Nyloc nuts","£1.60 &#187 Nyloc nuts stainless steel grade A4","M10 comes as pack of 2 , M12 comes as a pack of 1.<p>&nbsp</p><ul> <li>These fixings are A4 stainless steel.It has a far greater resistance to saltwater corrosion. A4 is the stainless steel grade normally required for saltwater applications. </li></ul>");
s++; item[s]=new Array("fastenings_-_nuts_washers_standard_nut.html","../images/dinghyfasteningsstandardnuttmb.jpg","Fastenings - nuts washers &#187 Standard nut","£1.60 &#187 Standard nuts stainless steel grade A4","<ul> <li>M3 qty per pack 10</li> <li>M4 qty per pack 10</li> <li>M5 qty per pack 10</li> <li>M6 qty per pack 5</li></ul>");
s++; item[s]=new Array("fastenings_-_nuts_washers_washers.html","../images/dinghyfasteningssmallwashertmb.jpg","Fastenings - nuts washers &#187 Washers","£2.00 &#187 Standard flat washers stainless steel grade A4","<ul> <li>M3 qty per pack 20</li> <li>M4 qty per pack 20</li> <li>M5 qty per pack 10</li> <li>M6 qty per pack 10</li></ul>.<p>&nbsp</p><ul> <li>These fixings are A4 stainless steel.It has a far greater resistance to saltwater corrosion. A4 is the stainless steel grade normally required for saltwater applications. </li></ul>");
s++; item[s]=new Array("fastenings_-_nuts_washers_washers.html","../images/dinghyfasteningshalpennywashertmb.jpg","Fastenings - nuts washers &#187 Washers","£1.30 &#187 Half penny flat washers stainless steel grade A4","<ul> <li>M4 qty per pack 15</li> <li>M5 qty per pack 10</li> <li>M6 qty per pack 5</li></ul>.<p>&nbsp</p><ul> <li>These fixings are A4 stainless steel.It has a far greater resistance to saltwater corrosion. A4 is the stainless steel grade normally required for saltwater applications. </li></ul>");
s++; item[s]=new Array("fastenings_-_nuts_washers_washers.html","../images/dinghyfasteningspennywashertmb.jpg","Fastenings - nuts washers &#187 Washers","£1.20 &#187 Penny flat washers stainless steel grade A4","Pack of 2.<p>&nbsp</p><ul> <li>These fixings are A4 stainless steel.It has a far greater resistance to saltwater corrosion. A4 is the stainless steel grade normally required for saltwater applications. </li></ul>");
s++; item[s]=new Array("fastenings_-_nuts_washers_washers.html","../images/dinghyfasteningspennywashertmb.jpg","Fastenings - nuts washers &#187 Washers","£1.99 &#187 Penny flat washers","Pack of 2.<p>&nbsp</p><ul> <li>These fixings are A4 stainless steel.It has a far greater resistance to saltwater corrosion. A4 is the stainless steel grade normally required for saltwater applications. </li></ul>");
s++; item[s]=new Array("fastenings_-_nuts_washers_wing_nut.html","../images/dinghyfasteningswingnuttmb.jpg","Fastenings - nuts washers &#187 Wing nut","£2.15 &#187 Wing nuts stainless steel grade A4","Comes in packs of 2.<p>&nbsp</p><ul> <li>These fixings are A4 stainless steel.It has a far greater resistance to saltwater corrosion. A4 is the stainless steel grade normally required for saltwater applications. </li></ul>");
s++; item[s]=new Array("fastenings_-_pins_&_rings_clevis_pins.html","../images/dinghyfasteningsclevispintmb.jpg","Fastenings - pins & rings &#187 Clevis pins","£1.50 &#187 Clevis pins diameter 4.8mm","Quantity 1 complete with split ring");
s++; item[s]=new Array("fastenings_-_pins_&_rings_clevis_pins.html","../images/dinghyfasteningsclevispintmb.jpg","Fastenings - pins & rings &#187 Clevis pins","£2.25 &#187 Clevis pins diameter 6.0mm","Quantity 1 complete with split ring");
s++; item[s]=new Array("fastenings_-_pins_&_rings_cotter_pins.html","../images/dinghyfasteningscotterpintmb.jpg","Fastenings - pins & rings &#187 Cotter pins","£1.60 &#187 Cotter pins stainless steel grade A2 1.5mm diameter","<ul> <li>12mm qty per pack 12</li> <li>20mm qty per pack 10</li> <li>25mm qty per pack 10 <blockquote> <p>These fixings are A2 stainless steel.It is suitable for most non-saltwater marine and domestic applications. </p> </blockquote> </li></ul>");
s++; item[s]=new Array("fastenings_-_pins_&_rings_cotter_pins.html","../images/dinghyfasteningscotterpintmb.jpg","Fastenings - pins & rings &#187 Cotter pins","£1.60 &#187 Cotter pins stainless steel grade A2 2.4 mm diameter","<ul> <li>20 mm qty per pack 8</li> <li>25 mm qty per pack 8</li> <li>38 mm qty per pack 3</li> <li>50 mm qty per pack 3 <blockquote> <p>These fixings are A2 stainless steel.It is suitable for most non-saltwater marine and domestic applications. </p> </blockquote> </li></ul>");
s++; item[s]=new Array("fastenings_-_pins_&_rings_cotter_pins.html","../images/dinghyfasteningscotterpintmb.jpg","Fastenings - pins & rings &#187 Cotter pins","£1.60 &#187 Cotter pins stainless steel grade A2 3 mm diameter","<ul> <li>20 mm qty per pack 3</li> <li>25 mm qty per pack 3</li> <li>38 mm qty per pack 3</li> <li>50 mm qty per pack 3 </li> <li>62 mm qty per pack 1 <blockquote> <p>These fixings are A2 stainless steel.It is suitable for most non-saltwater marine and domestic applications. </p> </blockquote> </li></ul>");
s++; item[s]=new Array("fastenings_-_pins_&_rings_cotter_pins.html","../images/dinghyfasteningscotterpintmb.jpg","Fastenings - pins & rings &#187 Cotter pins","£1.60 &#187 Cotter pins stainless steel grade A2 4 mm diameter","Come in packs of 2 <p>These fixings are A2 stainless steel.It is suitable for most non-saltwater marine and domestic applications. </p> </blockquote> </li></ul>");
s++; item[s]=new Array("fastenings_-_pins_&_rings_drop_nose_pins.html","../images/dinghyfasteningsdropnosepintmb.jpg","Fastenings - pins & rings &#187 Drop nose pins","£9.99 &#187 RWO R8825","<p>Quantity 1</p><p>Toggle pins have a spring loaded togle that rotates and securely engages, until manually released.Has a deep groove in head to attach wire or rope for security</p><ul> <li><font size=2>Diameter 6mm useable length 35.0mm overall length 46.0mm</font></li></ul>");
s++; item[s]=new Array("fastenings_-_pins_&_rings_drop_nose_pins.html","../images/dinghyfasteningsdropnosepintmb.jpg","Fastenings - pins & rings &#187 Drop nose pins","£11.49 &#187 RWO R8834","<p>Quantity 1</p><p>Toggle pins have a spring loaded togle that rotates and securely engages, until manually released.Has a deep groove in head to attach wire or rope for security</p><ul> <li><font size=2>Diameter 8mm useable length 25.0mm overall length 36.0mm</font></li></ul>");
s++; item[s]=new Array("fastenings_-_pins_&_rings_drop_nose_pins.html","../images/dinghyfasteningsdropnosepintmb.jpg","Fastenings - pins & rings &#187 Drop nose pins","£11.99 &#187 RWO R8835","<p>Quantity 1</p><p>Toggle pins have a spring loaded togle that rotates and securely engages, until manually released.Has a deep groove in head to attach wire or rope for security</p><ul> <li><font size=2>Diameter 8mm useable length 35.0mm overall length 46.0mm</font></li></ul>");
s++; item[s]=new Array("fastenings_-_pins_&_rings_fast_pins.html","../images/holtallenha5005ha5006fastpinstmb.jpg","Fastenings - pins & rings &#187 Fast pins","£4.25 &#187 Holt Allen HA5006 and HA5005 Stainless steel fast pins","<p>Quantity 1</p><ul> <li><font size=1>HA5005 diameter 5mm useable length 12.5mm overall length 26.5mm Suitable for HA4272 (stay adjuster)</font></li> <li><font size=1>HA5006 diameter 6mmuseable length 5.0mm overall length 29.0mm Suitable for HA4772HT (stay adjuster)</font></li></ul>");
s++; item[s]=new Array("fastenings_-_pins_&_rings_fast_pins.html","../images/dinghyfasteningsrwofastpinstmb.jpg","Fastenings - pins & rings &#187 Fast pins","£4.49 &#187 RWO R6712","<p>Quantity 1</p><ul> <li><font size=2>Diameter 5mm useable length 12.0mm overall length 26.0mm</font></li></ul>");
s++; item[s]=new Array("fastenings_-_pins_&_rings_fast_pins.html","../images/dinghyfasteningsrwofastpinstmb.jpg","Fastenings - pins & rings &#187 Fast pins","£4.99 &#187 RWO R6719","<p>Quantity 1</p><ul> <li><font size=2>Diameter 5mm useable length 19.0mm overall length 32.0mm</font></li></ul>");
s++; item[s]=new Array("fastenings_-_pins_&_rings_fast_pins.html","../images/dinghyfasteningsfastpintmb.jpg","Fastenings - pins & rings &#187 Fast pins","£16.99 &#187 Quick Pin push button.RWO 6730","<p>Quantity 1</p><p>Quick pins are ideal for applications that need constant rapid single handed adjustment.Quick pins are manufactured to imperial sizes , its recommended the location hole should be no more than 1/64 larger than the pin diameter.</p><ul> <li><font size=2>Diameter6mm useable length 32.0mm overall length 57.0mm</font></li></ul>");
s++; item[s]=new Array("fastenings_-_pins_&_rings_split_rings.html","../images/dinghyfasteningssplitringstmb.jpg","Fastenings - pins & rings &#187 Split rings","£1.50 &#187 Split rings stainless steel grade A2","<ul> <li>10mm diameter qty per pack 10</li> <li>14mm diameter qty per pack 10</li> <li>19mm diameter qty per pack 6</li> <li>22mm diameter qty per pack 3</li></ul>");
s++; item[s]=new Array("hull_fittings_bailers.html","../images/bailersupershute60tmb.jpg","Hull fittings &#187 Bailers","£34.99 &#187 Supershute 60","Supershute 60 The IYE Super Shute is a lightweight yet robust bailer which offers quick drainage with ease of operation. Fitted as standard by many leading production dinghy builders. Manufactured from the tough salt-water resistant nylon and ABS plastic, each bailer is supplied boxed with stainless steel fixing nuts, bolts, packing washers, hole template and comprehensive fitting instructions.");
s++; item[s]=new Array("hull_fittings_bailers.html","../images/bailersupershute90tmb.jpg","Hull fittings &#187 Bailers","£65.99 &#187 Supershute 90","Supershute 90 The IYE Super Shute is a lightweight yet robust bailer which offers quick drainage with ease of operation. Fitted as standard by many leading production dinghy builders. Manufactured from the tough salt-water resistant nylon and ABS plastic, each bailer is supplied boxed with stainless steel fixing nuts, bolts, packing washers, hole template and comprehensive fitting instructions.");
s++; item[s]=new Array("hull_fittings_bailers.html","../images/bailerandersonlargetmb.jpg","Hull fittings &#187 Bailers","£49.99 &#187 Anderson Large","Anderson Large The world-famous Anderson self bailer is fitted as standard equipment by many of the world's leading boatbuilders and renowned for its efficient design and reliability. Manufactured from marine grade stainless steel, each bailer is supplied boxed with stainless steel fixing nuts, bolts, packing washers and integral grid.");
s++; item[s]=new Array("hull_fittings_bailers.html","../images/bailerandersonminitmb.jpg","Hull fittings &#187 Bailers","£36.99 &#187 Anderson Mini","Anderson Mini The world-famous Anderson self bailer is fitted as standard equipment by many of the world's leading boatbuilders and renowned for its efficient design and reliability. Manufactured from marine grade stainless steel, each bailer is supplied boxed with stainless steel fixing nuts, bolts, packing washers and integral grid.");
s++; item[s]=new Array("hull_fittings_bailers.html","../images/bailerandersonsupermaxtmb.jpg","Hull fittings &#187 Bailers","£63.55 &#187 Anderson Supermax","Anderson Supermax The world-famous Anderson self bailer is fitted as standard equipment by many of the world's leading boatbuilders and renowned for its efficient design and reliability. Manufactured from marine grade stainless steel, each bailer is supplied boxed with stainless steel fixing nuts, bolts, packing washers and integral grid.");
s++; item[s]=new Array("hull_fittings_bailers.html","../images/bailerandersonmediumtmb.jpg","Hull fittings &#187 Bailers","£59.50 &#187 Anderson Medium","Anderson Medium The world-famous Anderson self bailer is fitted as standard equipment by many of the world's leading boatbuilders and renowned for its efficient design and reliability. Manufactured from marine grade stainless steel, each bailer is supplied boxed with stainless steel fixing nuts, bolts, packing washers and integral grid.");
s++; item[s]=new Array("hull_fittings_bailers.html","../images/bailerandersonsuperminitmb.jpg","Hull fittings &#187 Bailers","£48.50 &#187 Anderson Super Mini","Anderson Super Mini The world-famous Anderson self bailer is fitted as standard equipment by many of the world's leading boatbuilders and renowned for its efficient design and reliability. Manufactured from marine grade stainless steel, each bailer is supplied boxed with stainless steel fixing nuts, bolts, packing washers and integral grid.");
s++; item[s]=new Array("hull_fittings_bungs.html","../images/bungrwosrewintmb.jpg","Hull fittings &#187 Bungs","£1.99 &#187 RWO screw thread","");
s++; item[s]=new Array("hull_fittings_bungs.html","../images/bungbayonettmb.jpg","Hull fittings &#187 Bungs","£1.99 &#187 Holt Allen bayonet","");
s++; item[s]=new Array("hull_fittings_bungs.html","../images/toppertravellerronstanbungtmb.jpg","Hull fittings &#187 Bungs","£3.10 &#187 Ronstan screw thread","");
s++; item[s]=new Array("hull_fittings_bungs.html","../images/bungholtrubbertmb.jpg","Hull fittings &#187 Bungs","£2.99 &#187 Holt rubber bung","Holt rubber bung pack of 3");
s++; item[s]=new Array("maintenance_cleaners.html","../images/harkenmclubehullkotetmb.jpg","Maintenance &#187 Cleaners","£24.99 &#187 Mclube Hullkote","<p>Hullkote combines the same very fast world renowned McLube proprietary formulation of our bonded PTFE suspension system with an entirely revolutionary citrus-based long lasting high gloss polish. The results have been remarkable, by all accounts. </p><ul> <li>Environmentally friendly citrus based hydrophobic polish designed for an easier, faster hull coating application… saving your team’s valuable time and strength for the race course. </li> <li>Citrus based natural degreaser and polish creates an ultra-smooth, well sealed finish with an excellent and long-lasting high gloss shine Same active ingredient suspension as Sailkote creating the same durable chemical bond as Sailkote Provides superior </li> <li>UV protection for your hull and spars from the damaging rays of the sun </li> <li>Very environmentally friendly and entirely safe for you to use </li> <li>No harmful petroleum distillates (used in most other polishes and wax products), no harsh solvents, and no nano-tech health or safety concerns here </li> <li>Keeps your hull cleaner, much longer than anything else available today </li> <li>Applies in half the time of standard petroleum based polishes (just wipe on and wipe off, no waiting for anything to dry) </li> <li>Deep, lustrous showroom quality shine </li> <li>Lasts more than one full year above the waterline and more than 20 days of hard use below the waterline (2-3 coats will increase performance and durability to more than 30 days below the waterline) Highly hydrophobic (repels water, dirt, salt, grime, oil deposits, etc.) Very, very fast </li></ul>");
s++; item[s]=new Array("maintenance_cleaners.html","../images/starbritesailandcanvascleanertmb.jpg","Maintenance &#187 Cleaners","£6.99 &#187 Starbrite sail and canvas cleaner","Sail & Canvas Cleaner 16 oz. Description: Biodegradable formula safely cleans and brightens all types of white and colored sails/fabrics. Features: Concentrated formula removes dirt, grease and light mildew stains from all types fabric. Will not weaken fabric or threads.");
s++; item[s]=new Array("maintenance_cleaners.html","../images/starbriteboatwashandwaxtmb.jpg","Maintenance &#187 Cleaners","£8.50 &#187 Starbrite boatwash and wax","Boat Wash & Wax 16 oz. Description: Biodegradable formula cleans, shines and leaves a protective coating all in one step. Features: Concentrated formula is phosphate free and low sudsing to help the environment. Add a few capfuls to a bucket of water and wash boat. Safe on all fiberglass, metal and painted surfaces.");
s++; item[s]=new Array("maintenance_lubricants.html","../images/holtprolubetmb.jpg","Maintenance &#187 Lubricants","£4.99 &#187 Holt pro lube 1 can 200ml","A silicone/PTFE super lubricant designed specifically for the marine environment Pro-lube is the answer to every sailor’s prayers. Non-staining Pro-lube dries to leave a high slip environment that provides lasting lubrication up to 80°C. Its uses are limitless: Spray it on luff grooves, sail slides, bat cars etc. and you won’t believe the difference it makes. Use Pro-lube on old worn spinnakers to help waterproof the cloth and revitalise the sail. Rejuvenate fittings with a quick spray that will make them run like new.");
s++; item[s]=new Array("maintenance_lubricants.html","../images/mclubetmb.jpg","Maintenance &#187 Lubricants","£9.99 &#187 McLube Dry lubricant 170 ml","Sailkote is specially formulated with Dupont Krytox®, an easily applied environmentally friendly translucent liquid lubricant specifically designed for marine use. It dries quickly to a hard, smooth, ultra-slick, hydrophobic dry coating that bonds tenaciously to almost any surface. And because Sailkote is a dry lubricant, it will not attract dirt or contaminants and will not transfer to other surfaces, or you. Sailkote is typically five times as effective, and lasts much longer than, wax, oil or Teflon® based lubricants.");
s++; item[s]=new Array("maintenance_lubricants.html","../images/mclubetmb.jpg","Maintenance &#187 Lubricants","£17.99 &#187 McLube Dry lubricant 470 ml","Sailkote is specially formulated with Dupont Krytox®, an easily applied environmentally friendly translucent liquid lubricant specifically designed for marine use. It dries quickly to a hard, smooth, ultra-slick, hydrophobic dry coating that bonds tenaciously to almost any surface. And because Sailkote is a dry lubricant, it will not attract dirt or contaminants and will not transfer to other surfaces, or you. Sailkote is typically five times as effective, and lasts much longer than, wax, oil or Teflon® based lubricants.");
s++; item[s]=new Array("maintenance_repairs.html","../images/bisonepoxyuniversaltmb.jpg","Maintenance &#187 Repairs","£4.50 &#187 Bison Universal epoxy","Epoxy Universal 24ml Two-part adhesive based on epoxy resins. Transparent resin and hardener. Field of application For bonding metals, crockery, china, crystal, glass, pearls, ivory, precious stones and various plastics, such as polyester, bakelite, formica, rigid polystyrene and acrylic glass (Perspex®). Not suitable for plastic materials such as polyethylene, P.T.F.E. and silicone rubber. Properties Temp. resistance: from - 20°C up to + 80°C. Frost resistance: good. Resistance to moisture: good. Resistance to chemicals: good. Filling capacity: good.");
s++; item[s]=new Array("maintenance_repairs.html","../images/plastimogelcoatfillertmb.jpg","Maintenance &#187 Repairs","£8.25 &#187 Plastimo Gel coat filler","Two-part polyester resin. Suitable for minor damage (scratches and small holes) in glassfibre and enamelled surfaces. •Can be over-painted to match initial colour scheme. •Can be combined with Marine Filler for larger repairs. •Fully cured in 60 min.to a waterproof, hard, «shiny white » finish. 250g");
s++; item[s]=new Array("maintenance_repairs.html","../images/plastimogrppastetmb.jpg","Maintenance &#187 Repairs","£6.99 &#187 Plastimo GRP paste","Two-part, glassfibre reinforced polyester paste. Suitable for repairing holes and gaps, deep gouges in glassfibre,aluminium,steel and wood. Can also be used on corroded iron sheets. •High strength bond for structural repair. •Extremely water-resistant. •Sets in 5 min.  can be sanded after another 10 min. 250 g");
s++; item[s]=new Array("maintenance_repairs.html","../images/plastimomarinefillertmb.jpg","Maintenance &#187 Repairs","£6.99 &#187 Plastimo Marine filler","Two-part,polyester paste. Suitable for filling and sealing large holes and cracks in hull materials such as glassfibre,steel aluminium and wood. •If used below the waterline,it must be over-painted with Gelcoat Filler or painted. •Paint-compatible. •Sets in 5 min.  can be machined, drilled, tapped and polished in further 20 min. 250g");
s++; item[s]=new Array("maintenance_repairs.html","../images/starbritesiliconesealanttmb.jpg","Maintenance &#187 Repairs","£6.99 &#187 Starbrite silicone sealant clear","Clear Marine Silicone Sealant 83ml Features: #1 selling marine sealant 100% marine grade silicone, won't turn yellow Remains flexible from -70oF to +480oF Bonds to fiberglass, plastic, wood, glass and metal Unaffected by sunlight, weathering, most chemicals and solvents Will not shrink or sag Can be removed easily - excellent for deck hardware Special marine formula can be used above and below the waterline Dries tack free in less than one hour, cures completely in 24 hours");
s++; item[s]=new Array("ropes_accessories.html","../images/holtallensplicingneedletmb.jpg","Ropes &#187 Accessories","£12.25 &#187 Splicing needle for 2 - 3mm ropes","");
s++; item[s]=new Array("ropes_accessories.html","../images/holtallensplicingfidtmb.jpg","Ropes &#187 Accessories","£20.99 &#187 Splicing fids for 3 - 6mm ropes","A pack containing two different sized fids.");
s++; item[s]=new Array("ropes_accessories.html","../images/fse4piecesplicingsettmb.jpg","Ropes &#187 Accessories","£14.99 &#187 FSE Splicing kit","A pack of 4 plastic splicing fids .Suitable for 4 to 8mm ropes");
s++; item[s]=new Array("ropes_accessories.html","../images/englishbraidwhippingtwinetmb.jpg","Ropes &#187 Accessories","£3.99 &#187 Whipping twine .Heavy duty and standard","Standard wax whipping twine on a 50metre roll.Heavy wax whipping twine on a 25metre roll.");
s++; item[s]=new Array("ropes_accessories.html","../images/optimistvectranropetmb.gif","Ropes &#187 Accessories","£See below &#187 Vectran Spools","<ul><li>Vectran 1.2 mm rope Quantity 15 metres</li><li>Vectran 3.0 mm rope Quantity 16 metres</li><li>Vectran 4.0 mm rope Quantity 12 metres</li></ul>");
s++; item[s]=new Array("ropes_english_braid.html","../images/englishbraidrope16plaitmatttmb.jpg","Ropes &#187 English Braid","£See below &#187 16 plait matt priced per metre","This rope is the traditional cruising sheet construction. It is made from spun polyester braided cover over a double braided core to give superb hand grip, yet high strength and low stretch. The 16 plait cover is soft yet durable and with the appearance of cotton but will not rot or degrade. Benefits Friendly on the hands even when wet Good grip, soft and flexible Low stretch and high strength Can be spliced by riggers Available in white and solid colours Diameter mm 8 10 Breaking load kg 1460 1580 <table width=18% border=1> <tr> <td width=19%>Diameter mm</td> <td width=4%>8</td> <td width=4%>10</td> </tr> <tr> <td width=19%>Breaking load kg</td> <td width=4%>1460</td> <td width=4%>1580</td> </tr></table>");
s++; item[s]=new Array("ropes_english_braid.html","../images/No Image","Ropes &#187 English Braid","£See below &#187 3 strand prestretch priced per metre","English Braids 3 strand polyester is a traditional rope made from high grade polyester. The rope is processed to reduce the extension under load to a minimum, yet retain the ability to be easily spliced. The durability of the the three strand rope construction is legendary and the ready splicing makes this rope forever popular with dinghy sailors. Benefits English Braids unique pre-stretching process gives the rope low stretch high strength yet keeps the superb handling qualities Extremely durable Easily spliced <table width=18% border=1> <tr> <td width=19%>Diameter mm</td> <td width=4%>3</td> <td width=4%>4</td> <td width=4%>5</td> <td width=4%>6</td> <td width=4%>7</td> <td width=4%>8</td> </tr> <tr> <td width=19%>Breaking load kg</td> <td width=4%>310</td> <td width=4%>580</td> <td width=4%>690</td> <td width=4%>1020</td> <td width=4%>1200</td> <td width=4%>1800</td> </tr></table>");
s++; item[s]=new Array("ropes_english_braid.html","","Ropes &#187 English Braid","£1.20 &#187 8 mm 3 strand prestretch priced per metre","English Braids 3 strand polyester is a traditional rope made from high grade polyester. The rope is processed to reduce the extension under load to a minimum, yet retain the ability to be easily spliced. The durability of the the three strand rope construction is legendary and the ready splicing makes this rope forever popular with dinghy sailors. Benefits English Braids unique pre-stretching process gives the rope low stretch high strength yet keeps the superb handling qualities Extremely durable Easily spliced <table width=18% border=1> <tr> <td width=19%>Diameter mm</td> <td width=4%>3</td> <td width=4%>4</td> <td width=4%>5</td> <td width=4%>6</td> <td width=4%>7</td> <td width=4%>8</td> </tr> <tr> <td width=19%>Breaking load kg</td> <td width=4%>310</td> <td width=4%>580</td> <td width=4%>690</td> <td width=4%>1020</td> <td width=4%>1200</td> <td width=4%>1800</td> </tr></table>");
s++; item[s]=new Array("ropes_english_braid.html","../images/No Image","Ropes &#187 English Braid","£See below &#187 8 plait prestretched priced per metre","8 plait pre-stretched polyester is a high performance line for dinghy halyards, control lines, outhauls, lanyards and leach lines. The rope has low stretch and high strength and excellent grip in jammers. Benefits Hard wearing Pre-stretched, resists kinking Precise sail control <table width=18% border=1> <tr> <td width=19%>Diameter mm</td> <td width=4%>2</td> <td width=4%>3</td> <td width=4%>4</td> <td width=4%>5</td> <td width=4%>6</td> <td width=4%>8</td> <td width=4%>10</td> </tr> <tr> <td width=19%>Breaking load kg</td> <td width=4%>32</td> <td width=4%>240</td> <td width=4%>450</td> <td width=4%>630</td> <td width=4%>710</td> <td width=4%>1000</td> <td width=4%>1700</td> </tr></table>");
s++; item[s]=new Array("ropes_english_braid.html","../images/englishbraidropebraidonbraidtmb.jpg","Ropes &#187 English Braid","£See below &#187 8mm braid on braid priced per metre","Braid on Braid ropes offer the cruising or racing yachtsman a sheet of outstanding performance. The rope is 100% polyester with a braided core covered with a durable braided cover, hence the name braid on braid. This construction gives the rope flexibility and durability which makes for good winching and block running. Braid on braid ropes are easily spliceable using hollow fids for forming eyes or for joining ropes. Benefits Superb handle / flexibility Low extension under load Easy to splice with good retained strength Wide range of diameters Non kinking Braid on braid is also designed for reefing lines, control lines. <table width=18% border=1> <tr> <td width=19%>Diameter mm</td> <td width=4%>8</td> <td width=4%>10</td> </tr> <tr> <td width=19%>Breaking load kg</td> <td width=4%>2000</td> <td width=4%>2550</td> </tr></table>");
s++; item[s]=new Array("ropes_english_braid.html","../images/englishbraidropebraidonbraidtmb.jpg","Ropes &#187 English Braid","£See below &#187 Braid on braid priced per metre","Braid on Braid ropes offer the cruising or racing yachtsman a sheet of outstanding performance. The rope is 100% polyester with a braided core covered with a durable braided cover, hence the name braid on braid. This construction gives the rope flexibility and durability which makes for good winching and block running. Braid on braid ropes are easily spliceable using hollow fids for forming eyes or for joining ropes. Benefits Superb handle / flexibility Low extension under load Easy to splice with good retained strength Wide range of diameters Non kinking Braid on braid is also designed for reefing lines, control lines. <table width=18% border=1> <tr> <td width=19%>Diameter mm</td> <td width=4%>8</td> <td width=4%>10</td> </tr> <tr> <td width=19%>Breaking load kg</td> <td width=4%>2000</td> <td width=4%>2550</td> </tr></table>");
s++; item[s]=new Array("ropes_english_braid.html","../images/englishbraidropedyneematmb.jpg","Ropes &#187 English Braid","£See below &#187 Dyneema priced per metre 1.0mm,1.5mm,2.0mm","Dyneemabraid - Dyneema* High Modular Polythene Core / Polyester Cover Dyneemabraid is a composite rope designed specifically for racing halyards. This rope uses the very latest generation of HMPE from DSM High Performance Fibres in the inner core. Dyneemabraid has been developed in conjunction with DSM for optimum performance and best value. The high performance of Dyneemabraid allows for reduced rope diameters and lower rope weight at mast height. Dyneemabraid halyards will out perform all polyester ropes and last much longer than Kevlar** aramid ropes. Benefits High strength, low stretch, low weight Excellent durability Best value for racing halyards 3 4 5 6 370 660 1170 1500 <table width=18% border=1> <tr> <td width=19%>Diameter mm</td> <td width=4%>3</td> <td width=4%>4</td> <td width=5%>5</td> <td width=68%>6</td> </tr> <tr> <td width=19%>Breaking load kg</td> <td width=4%>370</td> <td width=4%>660</td> <td width=5%>1170</td> <td width=68%>1500</td> </tr></table>");
s++; item[s]=new Array("ropes_english_braid.html","../images/No Image","Ropes &#187 English Braid","£See below &#187 Dyneema priced per metre 3.0mm,4.0mm,5.0mm,6.0mm","<p>Dyneemabraid - Dyneema High Modular Polythene Core / Polyester Cover </p><p>Dyneemabraid is a composite rope designed specifically for racing halyards.   This rope uses the very latest generation of HMPE from DSM High Performance   Fibres in the inner core. Dyneemabraid has been developed in conjunction with   DSM for optimum performance and best value. The high performance of Dyneemabraid   allows for reduced rope diameters and lower rope weight at mast height. Dyneemabraid   halyards will out perform all polyester ropes and last much longer than Kevlar   aramid ropes. Benefits High strength, low stretch, low weight Excellent durability   Best value for racing halyards. </p><p>Please add note as to preferred colourway.</p><table width=562 border=1 height=20>  <tr>     <td width=111 height=11>Diameter mm</td>    <td width=111 height=11>       <div align=center>3</div>    </td>    <td width=112 height=11>       <div align=center>4</div>    </td>    <td width=112 height=11>       <div align=center>5</div>    </td>    <td width=112 height=11>       <div align=center>6</div>    </td>  </tr>  <tr>     <td width=111 height=2>Colours</td>    <td width=111 height=2>       <ul>        <li> red/black</li>        <li> black/neon</li>        <li>pink/blue</li>      </ul>      </td>    <td width=112 height=2>       <ul>        <li>red/yellow</li>        <li>yellow/black</li>      </ul>    </td>    <td width=112 height=2>       <ul>        <li>red/yellow</li>        <li>yellow/black</li>      </ul>      </td>    <td width=112 height=2>       <ul>        <li>white/black</li>        <li>yellow/black</li>      </ul>      </td>  </tr>  <tr>     <td width=111>Breaking load kg</td>    <td width=111>       <div align=center>370</div>    </td>    <td width=112>       <div align=center>660</div>    </td>    <td width=112>       <div align=center>1170</div>    </td>    <td width=112>       <div align=center>1500</div>    </td>  </tr></table>");
s++; item[s]=new Array("ropes_english_braid.html","../images/englishbraidropedyneemalitetmb.jpg","Ropes &#187 English Braid","£1.60 &#187 6mm Dyneemalite priced per metre","Ultra light ropes with a Dyneema SK75 core and UV stabilised high tenacity polypropylene cover. Breaking load 6mm 500kgs Benefits Bright colours for instant recognition.");
s++; item[s]=new Array("ropes_english_braid.html","../images/englishbraidsv12tmb.jpg","Ropes &#187 English Braid","£See below &#187 V12 priced per metre.3mm,4mm.","Vectran V12 has been developed to provide a product with low creep and high strength. Originally popular with dinghy sailors the product has seen a new lease of life when being used for lashings to save weight.");
s++; item[s]=new Array("ropes_english_braid.html","../images/englishbraidropeflairlinepolyprotmb.jpg","Ropes &#187 English Braid","£See below &#187 Flair polypro priced per metre","Flairline is a 100% polypropylene rope with an attractive sexy colour mix for sheet ropes on 'wet' dinghys. This buoyant rope is soft and light yet has the performance for direct action from the rig. Benefits Strong light and buoyant Good handle with low stretch Attractive colouring <table width=18% border=1> <tr> <td width=19%>Diameter mm</td> <td width=4%>7</td> <td width=4%>9</td> </tr> <tr> <td width=19%>Breaking load kg</td> <td width=4%>830</td> <td width=4%>950</td> </tr></table>");
s++; item[s]=new Array("ropes_english_braid.html","../images/roosterropetmb.gif","Ropes &#187 English Braid","£1.30 &#187 7mm rooster rope","The rope has a light high stretch inner core which leaves the outer core to be the load bearer.Due to the unique design the outer core takes the load instead of the inner core.This helps to maintain stability and prevents the rope from tangling.");
s++; item[s]=new Array("ropes_english_braid.html","../images/englishbraidropeshockcordtmb.jpg","Ropes &#187 English Braid","£See below &#187 Shockcord priced per metre 3mm,4mm,5mm","Super stretch shock cords with over 100% stretch for best durability. Polyester cover on the white, polypropylene on the colours, all with natural rubber cores.Available in black or white with blue fleck.");
s++; item[s]=new Array("ropes_english_braid.html","../images/englishbraidropeshockcordtmb.jpg","Ropes &#187 English Braid","£See below &#187 Shockcord priced per metre 6mm,7mm,8mm","Super stretch shock cords with over 100% stretch for best durability. Polyester cover on the white, polypropylene on the colours, all with natural rubber cores.Available in black or white with blue fleck.");
s++; item[s]=new Array("ropes_english_braid.html","../images/englishbraidropesprintlinetmb.jpg","Ropes &#187 English Braid","£0.65 &#187 Sprintline priced per metre","Sprintline 16 plait pre-stretched polyester is a high performance line for dinghy halyards, control lines, outhauls, lanyards and leach lines. The line is smoother and more flexible than 8 plait but has the same low stretch and extended bright colour range. Benefits Allows for precision sail control Pre-stretched yet smooth and slinky Very durable <table width=18% border=1> <tr> <td width=19%>Diameter mm</td> <td width=4%>3</td> <td width=4%>4</td> <td width=4%>5</td> <td width=4%>6</td> </tr> <tr> <td width=19%>Breaking load kg</td> <td width=4%>180</td> <td width=4%>230</td> <td width=4%>600</td> <td width=4%>750</td> </tr></table>");
s++; item[s]=new Array("ropes_english_braid.html","../images/englishbraidscruisingdyneematmb.jpg","Ropes &#187 English Braid","£2.30 &#187 Cruising dyneema 6mm .Very popular with topper sailors as mainsheet.","Designed to provide a halfway house to the average sailor, the cruising Dyneema has proved to be an outstanding success. With lower water pick up, low stretch and brilliant handling characteristics the line has been widely accepted on both dingy and cruising boats. Critically the design has been focused on ensuring ease of splicing and workability. Covered in the standard 24 plait polyester cover, used for EB Braid on Braid, the Dyneema core is protected against heat and abrasion.Breaking load 1300kg.");
s++; item[s]=new Array("ropes_fse_robline.html","../images/fsedinghycontrollinetmb.jpg","Ropes &#187 FSE Robline","£See below &#187 Ronstan - FSE Dinghy Control Line 3mm,4mm Price per metre.","THE ULTIMATE DINGHY LINE Weight is a major concern when it comes to Dinghy performance. So, FSE Robline focused its R&D efforts on developing a high-tech, small-boat line with characteristics similar to its Admiral Dyneema® ropes. We only use the best PES, Diolen, for the cover and Dyneema® SK 75 for the core. For a better cover-core grip we impregnated the core with our unique S.Y.I.S. Thanks to this coating, you can strip the cover off where needed to save weight and decrease the diameter. Dinghy Control is a pure racing line.");
s++; item[s]=new Array("ropes_fse_robline.html","../images/fseocean3000tmb.jpg","Ropes &#187 FSE Robline","£See below &#187 Ronstan - FSE Ocean 3000 2.5mm, 3.0mm, 4.0mm price per metre","IMPREGNATED VECTRAN®-TESTED BY THE VOLVO OCEAN RACE Vectran® 3000 is perfect for halyards when you are looking for top performance from your dinghy. Vectran® fiber provides for low stretch and is highly resistant to abrasion. Making it tougher yet, Vectran® 3000 is impregnated to increase its UV resistance. CONSTRUCTION Vectran® 3000 is built from a 12-plait weave, which ensures easy splicing and the strongest breaking load possible. FSE Robline Impregnation provides additional protection against abrasion and UV rays.");
s++; item[s]=new Array("ropes_fse_robline.html","../images/fseracingsheettmb.jpg","Ropes &#187 FSE Robline","£See below &#187 Ronstan - FSE Racing Sheet 5mm,7mm Price per metre","WINNING SHEET FOR ALL DINGHY CLASSES Since its market entry, Racing Sheet has caused a revolution amongst dinghy fleets. It\'s used by World- and European-champion sailors, and has been brought aboard by a two-time Olympian. Racing Sheet has been developed in cooperation with our competitive sports partners, and it truly is the gold standard no matter the venue. CONSTRUCTION The sheet, constructed as a hollow-fiber plait, is made of impregnated polyamide and Dyneema® SK 75. These materials make the rope extremely abrasion-resistant and low stretch. The sheet is easy to grip, even when wet, and is easy to splice.");
s++; item[s]=new Array("ropes_laser_1_mainsheet.html","../images/roosterropetmb.gif","Ropes &#187 Laser 1 mainsheet","£1.30 &#187 7mm rooster rope","The rope has a light high stretch inner core which leaves the outer core to be the load bearer.Due to the unique design the outer core takes the load instead of the inner core.This helps to maintain stability and prevents the rope from tangling.");
s++; item[s]=new Array("ropes_topper_main_sheet.html","../images/englishbraidscruisingdyneematmb.jpg","Ropes &#187 Topper main sheet","£2.30 &#187 Cruising dyneema 6mm .Very popular with topper sailors as mainsheet.","Designed to provide a halfway house to the average sailor, the cruising Dyneema has proved to be an outstanding success. With lower water pick up, low stretch and brilliant handling characteristics the line has been widely accepted on both dingy and cruising boats. Critically the design has been focused on ensuring ease of splicing and workability. Covered in the standard 24 plait polyester cover, used for EB Braid on Braid, the Dyneema core is protected against heat and abrasion.Breaking load 1300kg.");
s++; item[s]=new Array("ropes_topper_main_sheet.html","../images/roosterropetmb.gif","Ropes &#187 Topper main sheet","£1.30 &#187 7mm rooster rope","The rope has a light high stretch inner core which leaves the outer core to be the load bearer.Due to the unique design the outer core takes the load instead of the inner core.This helps to maintain stability and prevents the rope from tangling.");
s++; item[s]=new Array("rudder_and_transom_accessories.html","../images/seasure2340tmb.jpg","Rudder and Transom &#187 Accessories","£1.53 &#187 Seasure clips code 23-40,23-84 ,23-86","<ul>  <li>23-40 suits 16mm outside diameter tiller extension</li>  <li>23-84 suits 19mm outside diameter tiller extension</li>  <li>23-86 suits 22mm outside diameter tiller extension </li></ul>");
s++; item[s]=new Array("rudder_and_transom_accessories.html","../images/ruddershearpintmb.jpg","Rudder and Transom &#187 Accessories","£1.40 &#187 Palstic rudder shear pin 57mm long 6mm diameter","Commonly used on 420s");
s++; item[s]=new Array("rudder_and_transom_accessories.html","../images/tillerextensionronstanrdtortmb.jpg","Rudder and Transom &#187 Accessories","£2.99 &#187 Ronstan round tiller adaptor rf3136","");
s++; item[s]=new Array("rudder_and_transom_accessories.html","../images/tillerextensionaccessoriesrwobntmb.jpg","Rudder and Transom &#187 Accessories","£2.30 &#187 RWO end stop","");
s++; item[s]=new Array("rudder_and_transom_accessories.html","../images/tillerextensionholtstdujtmb.jpg","Rudder and Transom &#187 Accessories","£3.99 &#187 RWO omniflex uj","");
s++; item[s]=new Array("rudder_and_transom_accessories.html","../images/tillerextensionblackfoamhandletmb.gif","Rudder and Transom &#187 Accessories","£6.99 &#187 Black foam tiller extension handle","");
s++; item[s]=new Array("rudder_and_transom_accessories.html","../images/tillerextensionmcfoamhandletmb.gif","Rudder and Transom &#187 Accessories","£6.99 &#187 Multi coloured foam tiller extension handle","");
s++; item[s]=new Array("rudder_and_transom_accessories.html","../images/tillerextensionronstanujtmb.jpg","Rudder and Transom &#187 Accessories","£10.99 &#187 Ronstan uj","");
s++; item[s]=new Array("rudder_and_transom_accessories.html","../images/tillerextensionholt4092ujtmb.jpg","Rudder and Transom &#187 Accessories","£9.99 &#187 Holt Allen HA 4092 tiller connector and bolt","");
s++; item[s]=new Array("rudder_and_transom_accessories.html","../images/tillerextensionholt4098ujtmb.jpg","Rudder and Transom &#187 Accessories","£9.99 &#187 Holt Allen HA 4098 tiller connector and plate","");
s++; item[s]=new Array("rudder_and_transom_accessories.html","../images/tillerextensionseasureujtmb.jpg","Rudder and Transom &#187 Accessories","£9.50 &#187 Seasure uj","");
s++; item[s]=new Array("rudder_and_transom_accessories.html","../images/tillerextensionaccessoriesrwor0851tmb.jpg","Rudder and Transom &#187 Accessories","£9.89 &#187 RWO tiller connector swivel and strap R0851","");
s++; item[s]=new Array("rudder_and_transom_accessories.html","../images/tillerextensionaccessoriesrwor0854tmb.jpg","Rudder and Transom &#187 Accessories","£10.49 &#187 RWO tiller connector swivel and plate R0854","");
s++; item[s]=new Array("rudder_and_transom_accessories.html","../images/tillerextensionaccessoriesrwoomniflexraceujtmb.jpg","Rudder and Transom &#187 Accessories","£12.99 &#187 RWO omniflex race uj","");
s++; item[s]=new Array("rudder_and_transom_seasure_-_rudder.html","../images/seasure1800tmb.jpeg","Rudder and Transom &#187 Seasure - Rudder","£12.60 &#187 Rudder Fittings - 25mm (1) Seasure P/No 18-00","Top rudder gudgeon , 2 hole mounting. Internal width 25mm");
s++; item[s]=new Array("rudder_and_transom_seasure_-_rudder.html","../images/seasure1800btmb.jpg","Rudder and Transom &#187 Seasure - Rudder","£20.99 &#187 Rudder Fittings - 25mm (1) Seasure P/No 18-00B","Top rudder gudgeon , 2 hole mounting with carbon bush. Internal width 25mm");
s++; item[s]=new Array("rudder_and_transom_seasure_-_rudder.html","../images/seasure1801tmb.jpg","Rudder and Transom &#187 Seasure - Rudder","£20.99 &#187 Rudder Fittings - 25mm (1) Seasure P/No 18-01","Top rudder pintle , 2 hole mounting .Internal width 25mm");
s++; item[s]=new Array("rudder_and_transom_seasure_-_rudder.html","../images/seasure1802tmb.jpg","Rudder and Transom &#187 Seasure - Rudder","£14.99 &#187 Rudder Fittings - 25mm (1) Seasure P/No 18-02","Bottom rudder gudgeon ,3 hole mounting .Internal width 25mm");
s++; item[s]=new Array("rudder_and_transom_seasure_-_rudder.html","../images/seasure1802btmb.jpg","Rudder and Transom &#187 Seasure - Rudder","£18.50 &#187 Rudder Fittings - 25mm (1) Seasure P/No 18-02B","Bottom rudder gudgeon ,3 hole mounting with carbon bush .Internal width 25mm");
s++; item[s]=new Array("rudder_and_transom_seasure_-_rudder.html","../images/seasure1803tmb.jpeg","Rudder and Transom &#187 Seasure - Rudder","£25.50 &#187 Rudder Fittings - 25mm (1) Seasure P/No 18-03","Bottom rudder pintle ,3 hole mounting.Internal width 25mm");
s++; item[s]=new Array("rudder_and_transom_seasure_-_rudder.html","../images/seasure1800tmb.jpeg","Rudder and Transom &#187 Seasure - Rudder","£16.50 &#187 Rudder Fittings - 32mm (1.25) Seasure P/No 18-43","Top rudder gudgeon ,2 hole mounting.Internal width 32mm");
s++; item[s]=new Array("rudder_and_transom_seasure_-_rudder.html","../images/seasure1800btmb.jpg","Rudder and Transom &#187 Seasure - Rudder","£22.50 &#187 Rudder Fittings - 32mm (1.25) Seasure P/No 18-43B","Top rudder gudgeon ,2 hole mounting with carbon bush.Internal width 32mm");
s++; item[s]=new Array("rudder_and_transom_seasure_-_rudder.html","../images/seasure1801tmb.jpg","Rudder and Transom &#187 Seasure - Rudder","£25.99 &#187 Rudder Fittings - 32mm (1.25) Seasure P/No 18-44","Top rudder pintle ,2 hole mounting .Internal width 32mm");
s++; item[s]=new Array("rudder_and_transom_seasure_-_rudder.html","../images/seasure1802tmb.jpg","Rudder and Transom &#187 Seasure - Rudder","£16.99 &#187 Rudder Fittings - 32mm (1.25) Seasure P/No 18-45","Bottom rudder gudgeon ,3 hole mounting .Internal width 32mm");
s++; item[s]=new Array("rudder_and_transom_seasure_-_rudder.html","../images/seasure1802btmb.jpg","Rudder and Transom &#187 Seasure - Rudder","£22.99 &#187 Rudder Fittings - 32mm (1.25) Seasure P/No 18-45B","Bottom rudder gudgeon ,3 hole mounting with carbon bush.Internal width 32mm");
s++; item[s]=new Array("rudder_and_transom_seasure_-_rudder.html","../images/seasure1803tmb.jpeg","Rudder and Transom &#187 Seasure - Rudder","£27.99 &#187 Rudder Fittings - 32mm (1.25) Seasure P/No 18-46","Bottom rudder pintle ,3 hole mounting.Internal width 32mm");
s++; item[s]=new Array("rudder_and_transom_seasure_-_rudder.html","../images/seasure1800tmb.jpeg","Rudder and Transom &#187 Seasure - Rudder","£14.50 &#187 Rudder Fittings - 38mm (1.5) Seasure P/No 18-04","Top rudder gudgeon ,2 hole mounting.Internal width 38mm");
s++; item[s]=new Array("rudder_and_transom_seasure_-_rudder.html","../images/seasure1800btmb.jpg","Rudder and Transom &#187 Seasure - Rudder","£22.99 &#187 Rudder Fittings - 38mm (1.5) Seasure P/No 18-04B","Top rudder gudgeon ,2 hole mounting with carbon bush.Internal width 38mm");
s++; item[s]=new Array("rudder_and_transom_seasure_-_rudder.html","../images/seasure1801tmb.jpg","Rudder and Transom &#187 Seasure - Rudder","£24.50 &#187 Rudder Fittings - 38mm (1.5) Seasure P/No 18-05","Top rudder pintle ,2 hole mounting.Internal width 38mm");
s++; item[s]=new Array("rudder_and_transom_seasure_-_rudder.html","../images/seasure1802tmb.jpg","Rudder and Transom &#187 Seasure - Rudder","£25.99 &#187 Rudder Fittings - 38mm (1.5) Seasure P/No 18-06","Bottom rudder gudgeon ,3 hole mounting.Internal width 38mm");
s++; item[s]=new Array("rudder_and_transom_seasure_-_rudder.html","../images/seasure1802btmb.jpg","Rudder and Transom &#187 Seasure - Rudder","£23.99 &#187 Rudder Fittings - 38mm (1.5) Seasure P/No 18-06B","Bottom rudder gudgeon ,3 hole mounting with carbon bush.Internal width 38mm");
s++; item[s]=new Array("rudder_and_transom_seasure_-_rudder.html","../images/seasure1803tmb.jpeg","Rudder and Transom &#187 Seasure - Rudder","£29.50 &#187 Rudder Fittings - 38mm (1.5) Seasure P/No 18-07","Bottom rudder pintle ,3 hole mounting.Internal width 38mm");
s++; item[s]=new Array("rudder_and_transom_seasure_-_rudder.html","../images/seasure1800tmb.jpeg","Rudder and Transom &#187 Seasure - Rudder","£14.50 &#187 Rudder Fittings - 54mm (2.125) Seasure P/No 18-08","Top rudder gudgeon ,2 hole mounting.Internal width 52mm");
s++; item[s]=new Array("rudder_and_transom_seasure_-_rudder.html","../images/seasure1800btmb.jpg","Rudder and Transom &#187 Seasure - Rudder","£21.99 &#187 Rudder Fittings - 54mm (2.125) Seasure P/No 18-08B","Top rudder gudgeon ,2 hole mounting with carbon bush.Internal width 52mm");
s++; item[s]=new Array("rudder_and_transom_seasure_-_rudder.html","../images/seasure1801tmb.jpg","Rudder and Transom &#187 Seasure - Rudder","£22.50 &#187 Rudder Fittings - 54mm (2.125) Seasure P/No 18-09","Top rudder pintle ,2 hole mounting .Internal width 52mm");
s++; item[s]=new Array("rudder_and_transom_seasure_-_rudder.html","../images/seasure1802tmb.jpg","Rudder and Transom &#187 Seasure - Rudder","£15.50 &#187 Rudder Fittings - 54mm (2.125) Seasure P/No 18-10","Bottom rudder gudgeon ,3 hole mounting .Internal width 52mm");
s++; item[s]=new Array("rudder_and_transom_seasure_-_rudder.html","../images/seasure1802btmb.jpg","Rudder and Transom &#187 Seasure - Rudder","£22.99 &#187 Rudder Fittings - 54mm (2.125) Seasure P/No 18-10B","Bottom rudder gudgeon ,3 hole mounting with carbon bush .Internal width 52mm");
s++; item[s]=new Array("rudder_and_transom_seasure_-_rudder.html","../images/seasure1803tmb.jpeg","Rudder and Transom &#187 Seasure - Rudder","£29.50 &#187 Rudder Fittings - 54mm (2.125) Seasure P/No 18-11","Bottom rudder pintle ,3 hole mounting .Internal width 52mm");
s++; item[s]=new Array("rudder_and_transom_seasure_-_transom.html","../images/seasure1812tmb.jpg","Rudder and Transom &#187 Seasure - Transom","£9.50 &#187 Transom Fittings P/No 18-12","Top transom gudgeon,2 hole mounting 6mm diameter mounting hole. Dimension A 22mm.");
s++; item[s]=new Array("rudder_and_transom_seasure_-_transom.html","../images/seasure1812tmb.jpg","Rudder and Transom &#187 Seasure - Transom","£13.50 &#187 Transom Fittings P/No 18-12B","Top transom gudgeon,2 hole mounting 6mm diameter mounting hole with carbon bush. Dimension A 22mm.");
s++; item[s]=new Array("rudder_and_transom_seasure_-_transom.html","../images/seasure1813tmb.jpg","Rudder and Transom &#187 Seasure - Transom","£18.50 &#187 Transom Fittings P/No 18-13","Top transom pintle,2 hole mounting 6mm diameter mounting holes. Dimension A 22mm.");
s++; item[s]=new Array("rudder_and_transom_seasure_-_transom.html","../images/seasure1814tmb.jpg","Rudder and Transom &#187 Seasure - Transom","£18.50 &#187 Transom Fittings P/No 18-14","Top transom pintle,4 hole mounting 5mm diameter mounting holes. Dimension A 29mm.");
s++; item[s]=new Array("rudder_and_transom_seasure_-_transom.html","../images/seasure1815tmb.jpg","Rudder and Transom &#187 Seasure - Transom","£10.99 &#187 Transom Fittings P/No 18-15","Bottom transom gudgeon,4 hole mounting 5mm diameter mounting holes. Dimension A 29mm.");
s++; item[s]=new Array("rudder_and_transom_seasure_-_transom.html","../images/seasure1815tmb.jpg","Rudder and Transom &#187 Seasure - Transom","£14.50 &#187 Transom Fittings P/No 18-15B","Bottom transom gudgeon,4 hole mounting 5mm diameter mounting holes, with carbon bush. Dimension A 29mm.");
s++; item[s]=new Array("rudder_and_transom_seasure_-_transom.html","../images/seasure1817tmb.jpg","Rudder and Transom &#187 Seasure - Transom","£9.50 &#187 Transom Fittings P/No 18-16","Top transom gudgeon,2 hole mounting 5mm diameter mounting holes. Dimension A 22mm. B 48mm C 35.2mm D 75..6mm");
s++; item[s]=new Array("rudder_and_transom_seasure_-_transom.html","../images/seasure1817tmb.jpg","Rudder and Transom &#187 Seasure - Transom","£16.50 &#187 Transom Fittings P/No 18-16B","Top transom gudgeon,2 hole mounting 5mm diameter mounting holes, with carbon bush. Dimension A 22mm. B 48mm C 35.2mm D 75..6mm");
s++; item[s]=new Array("rudder_and_transom_seasure_-_transom.html","../images/seasure1817tmb.jpg","Rudder and Transom &#187 Seasure - Transom","£9.50 &#187 Transom Fittings P/No 18-17","Top transom gudgeon ( lightweight) ,2 hole mounting 5mm diameter mounting holes. Dimension A 13mm. B 48mm C 35.2mm D 75..6mm");
s++; item[s]=new Array("rudder_and_transom_seasure_-_transom.html","../images/seasure1818tmb.jpg","Rudder and Transom &#187 Seasure - Transom","£15.99 &#187 Transom Fittings P/No 18-18","Top transom Pintle ( lightweight) ,2 hole mounting 5mm diameter mounting holes. Dimension A 13mm. B 48mm C 35.2mm D 75..6mm");
s++; item[s]=new Array("rudder_and_transom_tiller_extensions.html","../images/tillerextension4298btmb.jpg","Rudder and Transom &#187 Tiller extensions","£24.99 &#187 Holt allen ha 4898 60.9cm tiller extension in red","Description Made from high marine grade aluminium our tiller extensions are stiff and light.They are supplied complete with a soft foam grip, grip end cap, and tiller joint .");
s++; item[s]=new Array("rudder_and_transom_tiller_extensions.html","","Rudder and Transom &#187 Tiller extensions","£26.99 &#187 Holt allen ha 4298 76.2cm tiller extension in blue","Description Made from high marine grade aluminium our tiller extensions are stiff and light.They are supplied complete with a soft foam grip, grip end cap, and tiller joint .");
s++; item[s]=new Array("rudder_and_transom_tiller_extensions.html","","Rudder and Transom &#187 Tiller extensions","£27.99 &#187 Holt allen ha 4498 91.5cm tiller extension","Description Made from high marine grade aluminium our tiller extensions are stiff and light.They are supplied complete with a soft foam grip, grip end cap, and tiller joint .");
s++; item[s]=new Array("rudder_and_transom_tiller_extensions.html","","Rudder and Transom &#187 Tiller extensions","£30.50 &#187 Holt allen ha 4698 106.7cm tiller extension","Description Made from high marine grade aluminium our tiller extensions are stiff and light.They are supplied complete with a soft foam grip, grip end cap, and tiller joint .");
s++; item[s]=new Array("rudder_and_transom_tiller_extensions.html","../images/tillerextensionronstantelescopictmb.jpg","Rudder and Transom &#187 Tiller extensions","£30.99 &#187 Ronstan tiller extension battlestick 60 cm","Lightweight, rigid construction Secure, comfortable grip Quick fitting universal joint for accurate helm response Firm Grip, Precision Control – Ronstan Batlestick™ tiller extensions provide the highest level of control, for quick, decisive helm response in every situation. The Evalon® Grip is a firm non-slip grip material that does not absorb water. End knob for safety and positive hand positioning. Large grip diameter contrasts erganomically with mainsheet diameter to relieve fatigue. Ronstan’s unique fluted profile adds extra rigidity to the lightweight alloy section. Tubes have a black anodised finish for corrosion protection. Urethane Universal Joint provides smooth, uniform rotation in all directions and a quick, firm reponse to steering movements.");
s++; item[s]=new Array("rudder_and_transom_tiller_extensions.html","","Rudder and Transom &#187 Tiller extensions","£35.50 &#187 Holt allen ha 4798 197.5cm tiller extension","Description Made from high marine grade aluminium our tiller extensions are stiff and light.They are supplied complete with a soft foam grip, grip end cap, and tiller joint .");
s++; item[s]=new Array("rudder_and_transom_tiller_extensions.html","../images/tillerextensionrwofixedlengthfastactmb.jpg","Rudder and Transom &#187 Tiller extensions","£33.49 &#187 RWO tiller extension fastac 90cm","This comprehensive range of RWO tiller eXtensions has been designed to increase sailing performance and comfort, by providing the skipper of any boat with a strong, reliable and easy-to-use piece of quality equipment. There is a model in the range to suit everyone, from the smallest sailing dinghy to the largest ocean racer. We believe the choice of eXtensions we offer is unparalleled anywhere else in the world. Fastac race version is fitted with RWO 'Race' Omniflex end with fibre core for extra security.");
s++; item[s]=new Array("rudder_and_transom_tiller_extensions.html","../images/tillerextensionholtcarbontmb.jpg","Rudder and Transom &#187 Tiller extensions","£40.50 &#187 Holt allen carbon tiller extension 60.9cm tiller with omniflex uj","Super Lightweight 100% carbon fibre ultra light tube with lightweight foam grip which now has chamfered ends for improved comfort. Super Stiff By using 19mm O/D tube instead of the standard 16mm O/D we have significantly increased the tube stiffness without increasing its weight. The larger diameter tube is more comfortable and easier to grip particularly through gloves or with wet or cold hands. Lightning Sticks put you firmly in control and give an amazingly responsive feel to the helm.");
s++; item[s]=new Array("rudder_and_transom_tiller_extensions.html","","Rudder and Transom &#187 Tiller extensions","£41.50 &#187 Holt allen carbon tiller extension 71cm tiller with omniflex uj","Super Lightweight 100% carbon fibre ultra light tube with lightweight foam grip which now has chamfered ends for improved comfort. Super Stiff By using 19mm O/D tube instead of the standard 16mm O/D we have significantly increased the tube stiffness without increasing its weight. The larger diameter tube is more comfortable and easier to grip particularly through gloves or with wet or cold hands. Lightning Sticks put you firmly in control and give an amazingly responsive feel to the helm.");
s++; item[s]=new Array("rudder_and_transom_tiller_extensions.html","../images/tillerextensionrwofixedlengthcarbolitetmb.jpg","Rudder and Transom &#187 Tiller extensions","£42.50 &#187 RWO tiller extension carbolite 80cm","This comprehensive range of RWO tiller eXtensions has been designed to increase sailing performance and comfort, by providing the skipper of any boat with a strong, reliable and easy-to-use piece of quality equipment. There is a model in the range to suit everyone, from the smallest sailing dinghy to the largest ocean racer. We believe the choice of eXtensions we offer is unparalleled anywhere else in the world. Fastac race version is fitted with RWO 'Race' Omniflex end with fibre core for extra security.");
s++; item[s]=new Array("rudder_and_transom_tiller_extensions.html","../images/tillerextensionrwotelescopictmb.jpg","Rudder and Transom &#187 Tiller extensions","£48.50 &#187 RWO tiller extension telescopic 70 - 122cm","Telescopic eXtensions (hiking sticks) will help to increase your sailing performance by enabling you to change the extension length 'at will', giving more comfort control and freedom of movement. To get the optimum performance from your boat, its balance on all points of sailing is paramount. Adjustable extensions allow the helm to move further forward or out to windward to achieve this. Lightweight anodised aluminium tube with a clearly indicated one way lock-unlock twist mechanism allowing infinite adjustment over length range. The non-slip foam supagrip and the contoured fluted end, give the helm a positive response in the wettest conditions. Fitted with omniflex uj");
s++; item[s]=new Array("rudder_and_transom_tiller_extensions.html","","Rudder and Transom &#187 Tiller extensions","£49.99 &#187 RWO tiller extension telescopic 100 - 180cm","Telescopic eXtensions (hiking sticks) will help to increase your sailing performance by enabling you to change the extension length 'at will', giving more comfort control and freedom of movement. To get the optimum performance from your boat, its balance on all points of sailing is paramount. Adjustable extensions allow the helm to move further forward or out to windward to achieve this. Lightweight anodised aluminium tube with a clearly indicated one way lock-unlock twist mechanism allowing infinite adjustment over length range. The non-slip foam supagrip and the contoured fluted end, give the helm a positive response in the wettest conditions. Fitted with omniflex uj");
s++; item[s]=new Array("rudder_and_transom_tiller_extensions.html","","Rudder and Transom &#187 Tiller extensions","£53.50 &#187 RWO tiller extension carbostik 120cm","This comprehensive range of RWO tiller eXtensions has been designed to increase sailing performance and comfort, by providing the skipper of any boat with a strong, reliable and easy-to-use piece of quality equipment. There is a model in the range to suit everyone, from the smallest sailing dinghy to the largest ocean racer. We believe the choice of eXtensions we offer is unparalleled anywhere else in the world. Fastac race version is fitted with RWO 'Race' Omniflex end with fibre core for extra security.");
s++; item[s]=new Array("rudder_and_transom_tiller_extensions.html","../images/tillerextensionronstancarbonx10tmb.jpg","Rudder and Transom &#187 Tiller extensions","£53.99 &#187 Ronstan tiller extension carbon 85cm","Fitted with ronstan uj");
s++; item[s]=new Array("rudder_and_transom_tiller_extensions.html","","Rudder and Transom &#187 Tiller extensions","£62.50 &#187 Holt allen carbon tiller extension 140cm tiller with omniflex uj","Super Lightweight 100% carbon fibre ultra light tube with lightweight foam grip which now has chamfered ends for improved comfort. Super Stiff By using 19mm O/D tube instead of the standard 16mm O/D we have significantly increased the tube stiffness without increasing its weight. The larger diameter tube is more comfortable and easier to grip particularly through gloves or with wet or cold hands. Lightning Sticks put you firmly in control and give an amazingly responsive feel to the helm.");
s++; item[s]=new Array("rudder_and_transom_tiller_extensions.html","","Rudder and Transom &#187 Tiller extensions","£57.99 &#187 RWO tiller extension telescopic 131 - 244cm","Telescopic eXtensions (hiking sticks) will help to increase your sailing performance by enabling you to change the extension length 'at will', giving more comfort control and freedom of movement. To get the optimum performance from your boat, its balance on all points of sailing is paramount. Adjustable extensions allow the helm to move further forward or out to windward to achieve this. Lightweight anodised aluminium tube with a clearly indicated one way lock-unlock twist mechanism allowing infinite adjustment over length range. The non-slip foam supagrip and the contoured fluted end, give the helm a positive response in the wettest conditions. Fitted with omniflex uj");
s++; item[s]=new Array("rudder_and_transom_tiller_extensions.html","","Rudder and Transom &#187 Tiller extensions","£76.50 &#187 Holt allen carbon tiller extension 190cm tiller with omniflex uj","Super Lightweight 100% carbon fibre ultra light tube with lightweight foam grip which now has chamfered ends for improved comfort. Super Stiff By using 19mm O/D tube instead of the standard 16mm O/D we have significantly increased the tube stiffness without increasing its weight. The larger diameter tube is more comfortable and easier to grip particularly through gloves or with wet or cold hands. Lightning Sticks put you firmly in control and give an amazingly responsive feel to the helm.");
s++; item[s]=new Array("rudder_and_transom_tiller_extensions.html","","Rudder and Transom &#187 Tiller extensions","£81.50 &#187 Holt allen carbon tiller extension 210cm tiller with omniflex uj","Super Lightweight 100% carbon fibre ultra light tube with lightweight foam grip which now has chamfered ends for improved comfort. Super Stiff By using 19mm O/D tube instead of the standard 16mm O/D we have significantly increased the tube stiffness without increasing its weight. The larger diameter tube is more comfortable and easier to grip particularly through gloves or with wet or cold hands. Lightning Sticks put you firmly in control and give an amazingly responsive feel to the helm.");
s++; item[s]=new Array("rudder_and_transom_tiller_extensions.html","","Rudder and Transom &#187 Tiller extensions","£92.99 &#187 Holt allen carbon tiller extension 250cm tiller with omniflex uj","Super Lightweight 100% carbon fibre ultra light tube with lightweight foam grip which now has chamfered ends for improved comfort. Super Stiff By using 19mm O/D tube instead of the standard 16mm O/D we have significantly increased the tube stiffness without increasing its weight. The larger diameter tube is more comfortable and easier to grip particularly through gloves or with wet or cold hands. Lightning Sticks put you firmly in control and give an amazingly responsive feel to the helm.");
s++; item[s]=new Array("rudder_and_transom_tiller_extensions.html","../images/tillerextensiontekmarinecarbontmb.jpg","Rudder and Transom &#187 Tiller extensions","£103.95 &#187 TEK marine tiller extension carbon 190cm","The Tek Marine Extensions use heavy duty cross 270gsm Toray carbon wound tube togive an incredibly tough and lightweight design. The extensions do not suffer from the brittleness of many inferior tubes, meaning they are far more forgiving if they are accidentally sat upon!!! Fantastic hoop strength, will not shatter Reinforced end for flexi joint with machine screw fixing Extremely stiff ergonomic 22mm diameter tube");
s++; item[s]=new Array("rudder_and_transom_tiller_extensions.html","","Rudder and Transom &#187 Tiller extensions","£127.99 &#187 TEK marine tiller extension carbon 250cm","The Tek Marine Extensions use heavy duty cross 270gsm Toray carbon wound tube togive an incredibly tough and lightweight design. The extensions do not suffer from the brittleness of many inferior tubes, meaning they are far more forgiving if they are accidentally sat upon!!! Fantastic hoop strength, will not shatter Reinforced end for flexi joint with machine screw fixing Extremely stiff ergonomic 22mm diameter tube");
s++; item[s]=new Array("sails_numbers_-_gbr's.html","../images/sailnumbersdigital8s230mmtmb.jpg","Sails &#187 Numbers - GBR's","£1.75 &#187 digital 8s 230mm","<a href=http://www.jonti.co.uk/html/topperchampionshipnumbers.pdf>Click here</a> for a PDF information sheet on how to number sail with Topper Championship numbers.");
s++; item[s]=new Array("sails_numbers_-_gbr's.html","../images/sailnumbers230mmtmb.jpg","Sails &#187 Numbers - GBR's","£1.75 &#187 Sail numbers and GBRs 230mm","<a href=http://www.jonti.co.uk/html/topperchampionshipnumbers.pdf>Click here</a> for a PDF information sheet on how to number sail with Topper Championship numbers.");
s++; item[s]=new Array("sails_numbers_-_gbr's.html","../images/sailnumbers310mmtmb.jpg","Sails &#187 Numbers - GBR's","£1.75 &#187 Sail numbers and GBRs 310mm","");
s++; item[s]=new Array("sails_numbers_-_gbr's.html","../images/sailnumbers230mmtmb.jpg","Sails &#187 Numbers - GBR's","£1.75 &#187 Sail numbers and GBRs 230mm","<a href=http://www.jonti.co.uk/html/topperchampionshipnumbers.pdf>Click here</a> for a PDF information sheet on how to number sail with Topper Championship numbers.");
s++; item[s]=new Array("sails_numbers_-_gbr's.html","../images/sailnumbers310mmtmb.jpg","Sails &#187 Numbers - GBR's","£1.75 &#187 Sail numbers and GBRs 310mm","");
s++; item[s]=new Array("sails_numbers_-_gbr's.html","../images/sailnumbers230mmtmb.jpg","Sails &#187 Numbers - GBR's","£1.75 &#187 Sail numbers and GBRs 230mm","<a href=http://www.jonti.co.uk/html/topperchampionshipnumbers.pdf>Click here</a> for a PDF information sheet on how to number sail with Topper Championship numbers.");
s++; item[s]=new Array("sails_numbers_-_gbr's.html","../images/sailnumbers230mmtmb.jpg","Sails &#187 Numbers - GBR's","£1.75 &#187 Sail numbers and GBRs 230mm","<a href=http://www.jonti.co.uk/html/topperchampionshipnumbers.pdf>Click here</a> for a PDF information sheet on how to number sail with Topper Championship numbers.");
s++; item[s]=new Array("sails_numbers_-_gbr's.html","../images/sailnumbers310mmtmb.jpg","Sails &#187 Numbers - GBR's","£1.75 &#187 Sail numbers and GBRs 310mm","");
s++; item[s]=new Array("sails_numbers_-_gbr's.html","../images/sailnumbers230mmtmb.jpg","Sails &#187 Numbers - GBR's","£1.75 &#187 Sail numbers and GBRs 230mm","<a href=http://www.jonti.co.uk/html/topperchampionshipnumbers.pdf>Click here</a> for a PDF information sheet on how to number sail with Topper Championship numbers.");
s++; item[s]=new Array("sails_numbers_-_gbr's.html","../images/sailnumbers310mmtmb.jpg","Sails &#187 Numbers - GBR's","£1.75 &#187 Sail numbers and GBRs 310mm","");
s++; item[s]=new Array("sails_numbers_-_gbr's.html","../images/sailnumbers230mmtmb.jpg","Sails &#187 Numbers - GBR's","£1.75 &#187 Sail numbers and GBRs 230mm","<a href=http://www.jonti.co.uk/html/topperchampionshipnumbers.pdf>Click here</a> for a PDF information sheet on how to number sail with Topper Championship numbers.");
s++; item[s]=new Array("sails_numbers_-_gbr's.html","../images/sailnumbers230mmtmb.jpg","Sails &#187 Numbers - GBR's","£1.75 &#187 Sail numbers and GBRs 230mm","<a href=http://www.jonti.co.uk/html/topperchampionshipnumbers.pdf>Click here</a> for a PDF information sheet on how to number sail with Topper Championship numbers.");
s++; item[s]=new Array("sails_numbers_-_gbr's.html","../images/sailnumbers310mmtmb.jpg","Sails &#187 Numbers - GBR's","£1.75 &#187 Sail numbers and GBRs 310mm","");
s++; item[s]=new Array("sails_numbers_-_gbr's.html","../images/sailnumbers230mmtmb.jpg","Sails &#187 Numbers - GBR's","£1.75 &#187 Sail numbers and GBRs 230mm","<a href=http://www.jonti.co.uk/html/topperchampionshipnumbers.pdf>Click here</a> for a PDF information sheet on how to number sail with Topper Championship numbers.");
s++; item[s]=new Array("sails_numbers_-_gbr's.html","../images/sailnumbers310mmtmb.jpg","Sails &#187 Numbers - GBR's","£1.75 &#187 Sail numbers and GBRs 310mm","");
s++; item[s]=new Array("sails_repair_tapes.html","../images/holtsailrepaikevlartapetmb.jpg","Sails &#187 Repair tapes","£9.50 &#187 PSP kevlar repair tape 75mm by 1.5m","<p>Kevlar Sail Repair Tape </p><p>Manufactured from a Kevlar scrim, encapsulated in a Mylar film then coated   with an aggressive UV resistant acrylic adhesive, ideal for repairs to laminate   sails. </p><ul>  <li>Colour Smoke Size 75mm x 1.5m rolls </li></ul>");
s++; item[s]=new Array("sails_repair_tapes.html","../images/holtsailrepaimylartmb.jpg","Sails &#187 Repair tapes","£5.50 &#187 PSP mylar repair tape","<p>Mylar Repair Tape </p><p>Remove the white release liner to expose a high clarity transparent repair   tape for semi-permanent repairs to sail windows and Mylar sails. UV and salt   water resistant. </p><p>Size 150mm x 3m (50 mu) rolls </p>");
s++; item[s]=new Array("sails_repair_tapes.html","../images/holtsailrepairheavydutysailreptmb.jpg","Sails &#187 Repair tapes","£7.99 &#187 PSP heavy duty repair tape","<p>Heavy Duty Sail Repair Tape </p><p>A self adhesive polyamide fabric tape for semi-permanent sail repair. Long   ageing and resistant to sea water and weather conditions. This tape is highly   conformable and exceptionally strong. </p><p>Colour: White Sizes: 100mm x 2m </p>");
s++; item[s]=new Array("sails_repair_tapes.html","../images/holtsailrepaispinnakerrtbtmb.jpg","Sails &#187 Repair tapes","£4.25 &#187 PSPspinnaker repair tape","<p>Spinnaker Repair Tape </p><p>This self-adhesive ripstop nylon tape is ideal for reinforcing batten pockets   and carrying out temporary repairs to torn sails.</p><p> Available in 14 colours Size 50mm x 4.5m</p>");
s++; item[s]=new Array("sails_tell_tales.html","../images/telltaleleechclothtmb.jpg","Sails &#187 Tell Tales","£3.99 &#187 Tell Tales Leech s039","Packed with fixing instructions");
s++; item[s]=new Array("sails_tell_tales.html","../images/telltaleshroudclothtmb.jpg","Sails &#187 Tell Tales","£3.99 &#187 Tell Tales shroud s043","Packed with fixing instructions");
s++; item[s]=new Array("sails_tell_tales.html","../images/telltaleheadsailclothtmb.jpg","Sails &#187 Tell Tales","£3.99 &#187 Tell Tales Head Sail s041","Packed with fixing instructions");
s++; item[s]=new Array("sails_tell_tales.html","../images/telltaleheadsailwooltmb.jpg","Sails &#187 Tell Tales","£3.99 &#187 Tell Tales Head Sail s040","Packed with fixing instructions");
s++; item[s]=new Array("sails_used.html","../images/laser400tmb.jpg","Sails &#187 Used","£99.00 &#187 Laser 4000 jib","Laser 4000 jib");
s++; item[s]=new Array("sails_used.html","../images/useddinghysaillaser1std67082tmb.jpg","Sails &#187 Used","£15.00 &#187 Laser 1 standard sail","");
s++; item[s]=new Array("shackles_1__standard_d.html","../images/shackleronstanrf151tmb.jpg","Shackles &#187 1. Standard D","£2.14 &#187 Standard slotted pin code rf150","<p>Grade 316 stainless steel bodies and pins </p><table width=93% border=1> <tr> <td width=23%><font size=2>Pin diameter/mm</font></td> <td width=25%><font size=2>Internal width/mm</font></td> <td width=29%><font size=2>Internal length/mm</font></td> <td width=23%><font size=2>Breaking load/kg</font></td> </tr> <tr> <td width=23%>4.8</td> <td width=25%>12</td> <td width=29%>18</td> <td width=23%>1400</td> </tr></table>");
s++; item[s]=new Array("shackles_1__standard_d.html","../images/shackleronstanrf151tmb.jpg","Shackles &#187 1. Standard D","£3.65 &#187 Standard slotted pin code rf151","<p>Grade 316 stainless steel bodies and pins </p><table width=93% border=1> <tr> <td width=23%><font size=2>Pin diameter/mm</font></td> <td width=25%><font size=2>Internal width/mm</font></td> <td width=29%><font size=2>Internal length/mm</font></td> <td width=23%><font size=2>Breaking load/kg</font></td> </tr> <tr> <td width=23%>6.4</td> <td width=25%>14</td> <td width=29%>22</td> <td width=23%>2300</td> </tr></table>");
s++; item[s]=new Array("shackles_1__standard_d.html","../images/shacklestandardbar16741tmb.jpg","Shackles &#187 1. Standard D","£1.79 &#187 Standard pin code ss 14-00","<p>Grade 316 stainless steel bodies and pins </p><table width=93% border=1> <tr> <td width=23%><font size=2>Pin diameter/mm</font></td> <td width=25%><font size=2>Internal width/mm</font></td> <td width=29%><font size=2>Internal length/mm</font></td> <td width=23%><font size=2>Breaking load/kg</font></td> </tr> <tr> <td width=23%>4</td> <td width=25%>8</td> <td width=29%>15</td> <td width=23%>1000</td> </tr></table>");
s++; item[s]=new Array("shackles_1__standard_d.html","../images/shacklestandardbar16741tmb.jpg","Shackles &#187 1. Standard D","£2.12 &#187 Standard pin code ss 14-01","<p>Grade 316 stainless steel bodies and pins </p><table width=93% border=1> <tr> <td width=23%><font size=2>Pin diameter/mm</font></td> <td width=25%><font size=2>Internal width/mm</font></td> <td width=29%><font size=2>Internal length/mm</font></td> <td width=23%><font size=2>Breaking load/kg</font></td> </tr> <tr> <td width=23%>5</td> <td width=25%>10</td> <td width=29%>17</td> <td width=23%>1500</td> </tr></table>");
s++; item[s]=new Array("shackles_1__standard_d.html","../images/shacklestandardbar16741tmb.jpg","Shackles &#187 1. Standard D","£2.75 &#187 Standard pin code ss 14-02","<p>Grade 316 stainless steel bodies and pins </p><table width=93% border=1> <tr> <td width=23%><font size=2>Pin diameter/mm</font></td> <td width=25%><font size=2>Internal width/mm</font></td> <td width=29%><font size=2>Internal length/mm</font></td> <td width=23%><font size=2>Breaking load/kg</font></td> </tr> <tr> <td width=23%>6</td> <td width=25%>12</td> <td width=29%>19</td> <td width=23%>1800</td> </tr></table>");
s++; item[s]=new Array("shackles_1__standard_d_-_captive_pin.html","../images/shacklestandardbar16741tmb.jpg","Shackles &#187 1. Standard D - Captive pin","£1.99 &#187 Standard retaining pin code ht 65104","<p>Technical Data Forging material: </p><ul> <li>AISI316 - DIN 1.4401 </li> <li>Casting Material: AISI316 - DIN 1.4408 </li> <li>Surface Treatment: E.P. (Electro polished) Breaking Load:</li> <li> Standard safety factor for working load is 1/4 of TDL (Tested deformation load) </li> <li>Application: Locking pin D-shackles are designed for application where accidental dropping of pin must be avoided during operation. Ex. high sea environment or high tower/pole locations. </li></ul><table width=93% border=1> <tr> <td width=23%><font size=2>Pin diameter/mm</font></td> <td width=25%><font size=2>Internal width/mm</font></td> <td width=29%><font size=2>Internal length/mm</font></td> <td width=23%><font size=2>Breaking load/kg</font></td> </tr> <tr> <td width=23%>4</td> <td width=25%>8</td> <td width=29%>16</td> <td width=23%>800</td> </tr></table>");
s++; item[s]=new Array("shackles_1__standard_d_-_captive_pin.html","../images/shacklestandardbar16741tmb.jpg","Shackles &#187 1. Standard D - Captive pin","£2.25 &#187 Standard retaining pin code ht 65105","<p>Technical Data Forging material: </p><ul> <li>AISI316 - DIN 1.4401 </li> <li>Casting Material: AISI316 - DIN 1.4408 </li> <li>Surface Treatment: E.P. (Electro polished) Breaking Load:</li> <li> Standard safety factor for working load is 1/4 of TDL (Tested deformation load) </li> <li>Application: Locking pin D-shackles are designed for application where accidental dropping of pin must be avoided during operation. Ex. high sea environment or high tower/pole locations. </li></ul><table width=93% border=1> <tr> <td width=23%><font size=2>Pin diameter/mm</font></td> <td width=25%><font size=2>Internal width/mm</font></td> <td width=29%><font size=2>Internal length/mm</font></td> <td width=23%><font size=2>Breaking load/kg</font></td> </tr> <tr> <td width=23%>5</td> <td width=25%>10</td> <td width=29%>20</td> <td width=23%>1000</td> </tr></table>");
s++; item[s]=new Array("shackles_1__standard_d_-_captive_pin.html","../images/shacklestandardbar16741tmb.jpg","Shackles &#187 1. Standard D - Captive pin","£2.99 &#187 Standard retaining pin code ht 65106","<p>Technical Data Forging material: </p><ul> <li>AISI316 - DIN 1.4401 </li> <li>Casting Material: AISI316 - DIN 1.4408 </li> <li>Surface Treatment: E.P. (Electro polished) Breaking Load:</li> <li> Standard safety factor for working load is 1/4 of TDL (Tested deformation load) </li> <li>Application: Locking pin D-shackles are designed for application where accidental dropping of pin must be avoided during operation. Ex. high sea environment or high tower/pole locations. </li></ul><table width=93% border=1> <tr> <td width=23%><font size=2>Pin diameter/mm</font></td> <td width=25%><font size=2>Internal width/mm</font></td> <td width=29%><font size=2>Internal length/mm</font></td> <td width=23%><font size=2>Breaking load/kg</font></td> </tr> <tr> <td width=23%>6</td> <td width=25%>12</td> <td width=29%>24</td> <td width=23%>1400</td> </tr></table>");
s++; item[s]=new Array("shackles_2__long_d.html","../images/shacklelongdtmb.jpg","Shackles &#187 2. Long D","£3.99 &#187 Long d shackle code 14-15","<p>Grade 316 stainless steel bodies and pins </p><table width=93% border=1> <tr> <td width=23%><font size=2>Pin diameter/mm</font></td> <td width=25%><font size=2>Internal width/mm</font></td> <td width=29%><font size=2>Internal length/mm</font></td> <td width=23%><font size=2>Breaking load/kg</font></td> </tr> <tr> <td width=23%>4</td> <td width=25%>8</td> <td width=29%>26</td> <td width=23%>1100</td> </tr></table>");
s++; item[s]=new Array("shackles_2__long_d.html","../images/shacklelongdtmb.jpg","Shackles &#187 2. Long D","£3.99 &#187 Long d shackle code 14-16","<p>Grade 316 stainless steel bodies and pins </p><table width=93% border=1> <tr> <td width=23%><font size=2>Pin diameter/mm</font></td> <td width=25%><font size=2>Internal width/mm</font></td> <td width=29%><font size=2>Internal length/mm</font></td> <td width=23%><font size=2>Breaking load/kg</font></td> </tr> <tr> <td width=23%>5</td> <td width=25%>11</td> <td width=29%>39</td> <td width=23%>1300</td> </tr></table>");
s++; item[s]=new Array("shackles_2__long_d.html","../images/shacklelongdtmb.jpg","Shackles &#187 2. Long D","£4.50 &#187 Long d shackle code 14-17","<p>Grade 316 stainless steel bodies and pins </p><table width=93% border=1> <tr> <td width=23%><font size=2>Pin diameter/mm</font></td> <td width=25%><font size=2>Internal width/mm</font></td> <td width=29%><font size=2>Internal length/mm</font></td> <td width=23%><font size=2>Breaking load/kg</font></td> </tr> <tr> <td width=23%>6</td> <td width=25%>12</td> <td width=29%>47</td> <td width=23%>2000</td> </tr></table>");
s++; item[s]=new Array("shackles_3__wide_d.html","../images/shacklewidedtmb.jpg","Shackles &#187 3. Wide D","£7.50 &#187 Wide D shackle code 14-44","<p>Grade 316 stainless steel bodies and pins </p><table width=93% border=1> <tr> <td width=23%><font size=2>Pin diameter/mm</font></td> <td width=25%><font size=2>Internal width/mm</font></td> <td width=29%><font size=2>Internal length/mm</font></td> <td width=23%><font size=2>Breaking load/kg</font></td> </tr> <tr> <td width=23%>5</td> <td width=25%>22</td> <td width=29%>36</td> <td width=23%>1000</td> </tr></table>");
s++; item[s]=new Array("shackles_3__wide_d.html","../images/shacklewidedtmb.jpg","Shackles &#187 3. Wide D","£8.50 &#187 Wide D shackle code 14-45","<p>Grade 316 stainless steel bodies and pins </p><table width=93% border=1> <tr> <td width=23%><font size=2>Pin diameter/mm</font></td> <td width=25%><font size=2>Internal width/mm</font></td> <td width=29%><font size=2>Internal length/mm</font></td> <td width=23%><font size=2>Breaking load/kg</font></td> </tr> <tr> <td width=23%>6</td> <td width=25%>28</td> <td width=29%>42</td> <td width=23%>1300</td> </tr></table>");
s++; item[s]=new Array("shackles_3__wide_d.html","../images/shackleronstanwidetmb.jpg","Shackles &#187 3. Wide D","£8.50 &#187 Wide D shackle code rf1850s","<p>Grade 316 stainless steel bodies and pins </p><table width=93% border=1> <tr> <td width=23%><font size=2>Pin diameter/mm</font></td> <td width=25%><font size=2>Internal width/mm</font></td> <td width=29%><font size=2>Internal length/mm</font></td> <td width=23%><font size=2>Breaking load/kg</font></td> </tr> <tr> <td width=23%>3.2</td> <td width=25%>13</td> <td width=29%>11</td> <td width=23%>550</td> </tr></table>");
s++; item[s]=new Array("shackles_3__wide_d.html","../images/shackleronstanwidetmb.jpg","Shackles &#187 3. Wide D","£8.50 &#187 Wide D shackle code rf1853","<p>Grade 316 stainless steel bodies and pins </p><table width=93% border=1> <tr> <td width=23%><font size=2>Pin diameter/mm</font></td> <td width=25%><font size=2>Internal width/mm</font></td> <td width=29%><font size=2>Internal length/mm</font></td> <td width=23%><font size=2>Breaking load/kg</font></td> </tr> <tr> <td width=23%>6.4</td> <td width=25%>31</td> <td width=29%>39</td> <td width=23%>2300</td> </tr></table>");
s++; item[s]=new Array("shackles_4__twisted.html","../images/shackletwistedstdtmb.jpg","Shackles &#187 4. Twisted","£3.25 &#187 Twisted shackle code ss14-35","<p>Grade 316 stainless steel bodies and pins </p><table width=93% border=1> <tr> <td width=23%><font size=2>Pin diameter/mm</font></td> <td width=25%><font size=2>Internal width/mm</font></td> <td width=29%><font size=2>Internal length/mm</font></td> <td width=23%><font size=2>Breaking load/kg</font></td> </tr> <tr> <td width=23%>4</td> <td width=25%>8</td> <td width=29%>32</td> <td width=23%>800</td> </tr></table>");
s++; item[s]=new Array("shackles_4__twisted.html","../images/shackletwistedstdtmb.jpg","Shackles &#187 4. Twisted","£3.50 &#187 Twisted shackle code ss14-36","<p>Grade 316 stainless steel bodies and pins </p><table width=93% border=1> <tr> <td width=23%><font size=2>Pin diameter/mm</font></td> <td width=25%><font size=2>Internal width/mm</font></td> <td width=29%><font size=2>Internal length/mm</font></td> <td width=23%><font size=2>Breaking load/kg</font></td> </tr> <tr> <td width=23%>5</td> <td width=25%>10</td> <td width=29%>36</td> <td width=23%>800</td> </tr></table>");
s++; item[s]=new Array("shackles_4__twisted.html","../images/shackleronstantwistedtmb.jpg","Shackles &#187 4. Twisted","£5.99 &#187 Twisted shackle code rf629","<p>Grade 316 stainless steel bodies and pins </p><table width=93% border=1> <tr> <td width=23%><font size=2>Pin diameter/mm</font></td> <td width=25%><font size=2>Internal width/mm</font></td> <td width=29%><font size=2>Internal length/mm</font></td> <td width=23%><font size=2>Breaking load/kg</font></td> </tr> <tr> <td width=23%>6.4</td> <td width=25%>13</td> <td width=29%>39</td> <td width=23%>2300</td> </tr></table>");
s++; item[s]=new Array("shackles_5__bow.html","../images/shacklebowtmb.jpg","Shackles &#187 5. Bow","£1.50 &#187 Bow shackle code HT65204","<p>Technical Data </p><ul> <li>Forging material: AISI316 - DIN 1.4401 </li> <li>Casting Material: AISI316 - DIN 1.4408 </li> <li>Surface Treatment: E.P. (Electro polished) </li> <li>Breaking Load: Standard safety factor for working load is 1/4 of TDL (Tested deformation load) </li> <li>Application: D-Shackles with fixed ring pins are designed for application where a more securely tight pin is required. </li></ul><table width=93% border=1> <tr> <td width=23%><font size=2>Pin diameter/mm</font></td> <td width=25%><font size=2>Internal width/mm</font></td> <td width=29%><font size=2>Internal length/mm</font></td> <td width=23%><font size=2>Breaking load/kg</font></td> </tr> <tr> <td width=23%>4</td> <td width=25%>8</td> <td width=29%>20</td> <td width=23%>550</td> </tr></table>");
s++; item[s]=new Array("shackles_5__bow.html","../images/shacklebowtmb.jpg","Shackles &#187 5. Bow","£1.75 &#187 Bow shackle code HT65205","<p>Technical Data </p><ul> <li>Forging material: AISI316 - DIN 1.4401 </li> <li>Casting Material: AISI316 - DIN 1.4408 </li> <li>Surface Treatment: E.P. (Electro polished) </li> <li>Breaking Load: Standard safety factor for working load is 1/4 of TDL (Tested deformation load) </li> <li>Application: D-Shackles with fixed ring pins are designed for application where a more securely tight pin is required. </li></ul><table width=93% border=1> <tr> <td width=23%><font size=2>Pin diameter/mm</font></td> <td width=25%><font size=2>Internal width/mm</font></td> <td width=29%><font size=2>Internal length/mm</font></td> <td width=23%><font size=2>Breaking load/kg</font></td> </tr> <tr> <td width=23%>5</td> <td width=25%>10</td> <td width=29%>25.5</td> <td width=23%>1200</td> </tr></table>");
s++; item[s]=new Array("shackles_5__bow.html","../images/shacklebowtmb.jpg","Shackles &#187 5. Bow","£1.99 &#187 Bow shackle code HT65206","<p>Technical Data </p><ul> <li>Forging material: AISI316 - DIN 1.4401 </li> <li>Casting Material: AISI316 - DIN 1.4408 </li> <li>Surface Treatment: E.P. (Electro polished) </li> <li>Breaking Load: Standard safety factor for working load is 1/4 of TDL (Tested deformation load) </li> <li>Application: D-Shackles with fixed ring pins are designed for application where a more securely tight pin is required. </li></ul><table width=93% border=1> <tr> <td width=23%><font size=2>Pin diameter/mm</font></td> <td width=25%><font size=2>Internal width/mm</font></td> <td width=29%><font size=2>Internal length/mm</font></td> <td width=23%><font size=2>Breaking load/kg</font></td> </tr> <tr> <td width=23%>6</td> <td width=25%>12</td> <td width=29%>30</td> <td width=23%>1700</td> </tr></table>");
s++; item[s]=new Array("shackles_5__halyard.html","../images/shaclehalyardholttmb.jpg","Shackles &#187 5. Halyard","£5.99 &#187 Halyard shackle code ht 63106","<p>Technical Data</p><ul> <li> Casting Material: AISI316 - DIN 1.4408 </li> <li>Surface Treatment: E.P. (Electro polished) </li> <li>Breaking Load: Standard safety factor for working load is 1/4 of TDL (Tested deformation load) </li> <li>Application: Crossbar halyard shackles are designed specifically for marine application where a quick 180? release pin as well as independent eye end is required. </li></ul><table width=93% border=1> <tr> <td width=23%><font size=2>Pin diameter/mm</font></td> <td width=25%><font size=2>Internal width/mm</font></td> <td width=29%><font size=2>Internal length/mm</font></td> <td width=23%><font size=2>Breaking load/kg</font></td> </tr> <tr> <td width=23%>5</td> <td width=25%>13</td> <td width=29%>40.5</td> <td width=23%>1000</td> </tr></table>");
s++; item[s]=new Array("shackles_5__halyard.html","../images/shacklerwohalyardtmb.jpg","Shackles &#187 5. Halyard","£6.99 &#187 Halyard shackle code r6170","<p>Technical Data</p><ul> <li> Electropolished stainless steel strong and reliable</li></ul><table width=93% border=1> <tr> <td width=23%><font size=2>Pin diameter/mm</font></td> <td width=25%><font size=2>Internal width/mm</font></td> <td width=29%><font size=2>Internal length/mm</font></td> <td width=23%><font size=2>Breaking load/kg</font></td> </tr> <tr> <td width=23%>6</td> <td width=25%>14</td> <td width=29%>41</td> <td width=23%>1500</td> </tr></table>");
s++; item[s]=new Array("shackles_5__halyard.html","../images/shackleronstanhalyardtmb.jpg","Shackles &#187 5. Halyard","£13.99 &#187 Halyard shackle code rf1034","<p>Technical Data</p><ul> <li> Grade 316 stainless steel bodies and pins </li> <li>Halyard shackles have a lever action for easy opening and closing, with a keyed pin for positive locking.</li></ul><table width=93% border=1> <tr> <td width=23%><font size=2>Pin diameter/mm</font></td> <td width=25%><font size=2>Internal width/mm</font></td> <td width=29%><font size=2>Internal length/mm</font></td> <td width=23%><font size=2>Breaking load/kg</font></td> </tr> <tr> <td width=23%>7.9</td> <td width=25%>20</td> <td width=29%>62</td> <td width=23%>2700</td> </tr></table>");
s++; item[s]=new Array("shackles_6__rigging_links.html","../images/shackleseasuestripshackletmb.jpg","Shackles &#187 6. Rigging links","£1.65 &#187 Rigging links code ss0529","<p>Technical Data</p><ul> <li> Grade 316 stainless steel bodies and pins </li></ul><table width=93% border=1> <tr> <td width=23%><font size=2>Pin diameter/mm</font></td> <td width=25%><font size=2>Internal width/mm</font></td> <td width=29%><font size=2>Internal length/mm</font></td> </tr> <tr> <td width=23%>4</td> <td width=25%>8</td> <td width=29%>11.5</td> </tr></table>");
s++; item[s]=new Array("shackles_6__rigging_links.html","../images/shackleseasuestripshackletmb.jpg","Shackles &#187 6. Rigging links","£1.65 &#187 Rigging links code ss0530","<p>Technical Data</p><ul> <li> Grade 316 stainless steel bodies and pins </li></ul><table width=93% border=1> <tr> <td width=23%><font size=2>Pin diameter/mm</font></td> <td width=25%><font size=2>Internal width/mm</font></td> <td width=29%><font size=2>Internal length/mm</font></td> </tr> <tr> <td width=23%>5</td> <td width=25%>10.5</td> <td width=29%>15</td> </tr></table>");
s++; item[s]=new Array("shackles_6__rigging_links.html","../images/shackleseasuestripshackletmb.jpg","Shackles &#187 6. Rigging links","£2.75 &#187 Rigging links code ss2521","<p>Technical Data</p><ul> <li> Grade 316 stainless steel bodies and pins </li></ul><table width=93% border=1> <tr> <td width=23%><font size=2>Pin diameter/mm</font></td> <td width=25%><font size=2>Internal width/mm</font></td> <td width=29%><font size=2>Internal length/mm</font></td> </tr> <tr> <td width=23%>5</td> <td width=25%>11.5</td> <td width=29%>32</td> </tr></table>");
s++; item[s]=new Array("shackles_6__rigging_links.html","../images/shackleseasuestripshackletmb.jpg","Shackles &#187 6. Rigging links","£2.75 &#187 Rigging links code r6350","<p>Technical Data</p><ul> <li> Grade 316 stainless steel bodies and pins </li></ul><table width=93% border=1> <tr> <td width=23%><font size=2>Pin diameter/mm</font></td> <td width=25%><font size=2>Internal width/mm</font></td> <td width=29%><font size=2>Internal length/mm</font></td> </tr> <tr> <td width=23%>5</td> <td width=25%>16</td> <td width=29%>22</td> </tr></table>");
s++; item[s]=new Array("shackles_6__rigging_links.html","../images/shacklerworigginglink6390tmb.jpg","Shackles &#187 6. Rigging links","£3.49 &#187 Rigging links code r6390","<p>Technical Data</p><ul> <li> Grade 316 stainless steel bodies and pins </li></ul><table width=93% border=1> <tr> <td width=23%><font size=2>Pin diameter/mm</font></td> <td width=25%><font size=2>Internal width/mm</font></td> <td width=29%><font size=2>Internal length/mm</font></td> </tr> <tr> <td width=23%>5</td> <td width=25%>25</td> <td width=29%>38</td> </tr></table>");
s++; item[s]=new Array("shackles_7__strip.html","../images/shacklesrwostriptmb.jpg","Shackles &#187 7. Strip","£1.25 &#187 Strip Shackle code r6040","<p>Technical Data</p><ul> <li> Elecrtopolished stainless steel that are economical , strong and reliable </li></ul><table width=93% border=1> <tr> <td width=23%><font size=2>Pin diameter/mm</font></td> <td width=25%><font size=2>Internal width/mm</font></td> <td width=29%><font size=2>Internal length/mm</font></td> <td width=23%><font size=2>Breaking load/kg</font></td> </tr> <tr> <td width=23%>4</td> <td width=25%>10</td> <td width=29%>16</td> <td width=23%>500</td> </tr></table>");
s++; item[s]=new Array("shackles_7__strip.html","../images/shacklesrwostriptmb.jpg","Shackles &#187 7. Strip","£1.75 &#187 Strip Shackle code r6041","<p>Technical Data</p><ul> <li> Elecrtopolished stainless steel that are economical , strong and reliable </li></ul><table width=93% border=1> <tr> <td width=23%><font size=2>Pin diameter/mm</font></td> <td width=25%><font size=2>Internal width/mm</font></td> <td width=29%><font size=2>Internal length/mm</font></td> <td width=23%><font size=2>Breaking load/kg</font></td> </tr> <tr> <td width=23%>4</td> <td width=25%>10</td> <td width=29%>20</td> <td width=23%>600</td> </tr></table>");
s++; item[s]=new Array("shackles_7__strip.html","../images/shacklesrwostriptmb.jpg","Shackles &#187 7. Strip","£2.25 &#187 Strip Shackle code r6042","<p>Technical Data</p><ul> <li> Elecrtopolished stainless steel that are economical , strong and reliable </li></ul><table width=93% border=1> <tr> <td width=23%><font size=2>Pin diameter/mm</font></td> <td width=25%><font size=2>Internal width/mm</font></td> <td width=29%><font size=2>Internal length/mm</font></td> <td width=23%><font size=2>Breaking load/kg</font></td> </tr> <tr> <td width=23%>4</td> <td width=25%>6</td> <td width=29%>21</td> <td width=23%>600</td> </tr></table>");
s++; item[s]=new Array("shackles_7__strip.html","../images/shacklesrwostriptmb.jpg","Shackles &#187 7. Strip","£1.45 &#187 Strip Shackle code r6050","<p>Technical Data</p><ul> <li> Elecrtopolished stainless steel that are economical , strong and reliable </li></ul><table width=93% border=1> <tr> <td width=23%><font size=2>Pin diameter/mm</font></td> <td width=25%><font size=2>Internal width/mm</font></td> <td width=29%><font size=2>Internal length/mm</font></td> <td width=23%><font size=2>Breaking load/kg</font></td> </tr> <tr> <td width=23%>5</td> <td width=25%>12</td> <td width=29%>17</td> <td width=23%>1000</td> </tr></table>");
s++; item[s]=new Array("shackles_7__strip.html","../images/shacklesrwostriptmb.jpg","Shackles &#187 7. Strip","£1.99 &#187 Strip Shackle code r6051","<p>Technical Data</p><ul> <li> Elecrtopolished stainless steel that are economical , strong and reliable </li></ul><table width=93% border=1> <tr> <td width=23%><font size=2>Pin diameter/mm</font></td> <td width=25%><font size=2>Internal width/mm</font></td> <td width=29%><font size=2>Internal length/mm</font></td> <td width=23%><font size=2>Breaking load/kg</font></td> </tr> <tr> <td width=23%>5</td> <td width=25%>16</td> <td width=29%>24</td> <td width=23%>1000</td> </tr></table>");
s++; item[s]=new Array("shackles_7__strip.html","../images/shacklesrwostriptmb.jpg","Shackles &#187 7. Strip","£1.99 &#187 Strip Shackle code r6052","<p>Technical Data</p><ul> <li> Elecrtopolished stainless steel that are economical , strong and reliable </li></ul><table width=93% border=1> <tr> <td width=23%><font size=2>Pin diameter/mm</font></td> <td width=25%><font size=2>Internal width/mm</font></td> <td width=29%><font size=2>Internal length/mm</font></td> <td width=23%><font size=2>Breaking load/kg</font></td> </tr> <tr> <td width=23%>5</td> <td width=25%>12</td> <td width=29%>25</td> <td width=23%>1200</td> </tr></table>");
s++; item[s]=new Array("shackles_7__strip.html","../images/shacklesrwostriptmb.jpg","Shackles &#187 7. Strip","£2.45 &#187 Strip Shackle code r6053","<p>Technical Data</p><ul> <li> Elecrtopolished stainless steel that are economical , strong and reliable </li></ul><table width=93% border=1> <tr> <td width=23%><font size=2>Pin diameter/mm</font></td> <td width=25%><font size=2>Internal width/mm</font></td> <td width=29%><font size=2>Internal length/mm</font></td> <td width=23%><font size=2>Breaking load/kg</font></td> </tr> <tr> <td width=23%>5</td> <td width=25%>16</td> <td width=29%>36</td> <td width=23%>1200</td> </tr></table>");
s++; item[s]=new Array("shackles_7__strip.html","../images/shacklesrwostriptmb.jpg","Shackles &#187 7. Strip","£2.50 &#187 Strip Shackle code r6054","<p>Technical Data</p><ul> <li> Elecrtopolished stainless steel that are economical , strong and reliable </li></ul><table width=93% border=1> <tr> <td width=23%><font size=2>Pin diameter/mm</font></td> <td width=25%><font size=2>Internal width/mm</font></td> <td width=29%><font size=2>Internal length/mm</font></td> <td width=23%><font size=2>Breaking load/kg</font></td> </tr> <tr> <td width=23%>5</td> <td width=25%>8</td> <td width=29%>19</td> <td width=23%>1200</td> </tr></table>");
s++; item[s]=new Array("shackles_7__strip_-_captive_pin.html","../images/shacklerwostripcaptivepintmb.jpg","Shackles &#187 7. Strip - Captive pin","£2.50 &#187 Strip Shackle with a captive pin code r6180","<p>Technical Data</p><ul> <li> Elecrtopolished stainless steel that are economical , strong and reliable</li> <li>Half turn opens shackle but pin remains captured and cannot be lost.</li></ul><table width=93% border=1> <tr> <td width=23%><font size=2>Pin diameter/mm</font></td> <td width=25%><font size=2>Internal width/mm</font></td> <td width=29%><font size=2>Internal length/mm</font></td> <td width=23%><font size=2>Breaking load/kg</font></td> </tr> <tr> <td width=23%>4</td> <td width=25%>10</td> <td width=29%>20</td> <td width=23%>600</td> </tr></table>");
s++; item[s]=new Array("shackles_7__strip_-_captive_pin.html","../images/shacklerwostripcaptivepintmb.jpg","Shackles &#187 7. Strip - Captive pin","£2.50 &#187 Strip Shackle with a captive pin code r6182","<p>Technical Data</p><ul> <li> Elecrtopolished stainless steel that are economical , strong and reliable</li> <li>Half turn opens shackle but pin remains captured and cannot be lost.</li></ul><table width=93% border=1> <tr> <td width=23%><font size=2>Pin diameter/mm</font></td> <td width=25%><font size=2>Internal width/mm</font></td> <td width=29%><font size=2>Internal length/mm</font></td> <td width=23%><font size=2>Breaking load/kg</font></td> </tr> <tr> <td width=23%>5</td> <td width=25%>15</td> <td width=29%>25</td> <td width=23%>1200</td> </tr></table>");
s++; item[s]=new Array("shackles_7__strip_-_captive_pin.html","../images/shacklerwostripcaptivepintmb.jpg","Shackles &#187 7. Strip - Captive pin","£2.99 &#187 Strip Shackle with a captive pin code r6183","<p>Technical Data</p><ul> <li> Elecrtopolished stainless steel that are economical , strong and reliable</li> <li>Half turn opens shackle but pin remains captured and cannot be lost.</li></ul><table width=93% border=1> <tr> <td width=23%><font size=2>Pin diameter/mm</font></td> <td width=25%><font size=2>Internal width/mm</font></td> <td width=29%><font size=2>Internal length/mm</font></td> <td width=23%><font size=2>Breaking load/kg</font></td> </tr> <tr> <td width=23%>5</td> <td width=25%>12</td> <td width=29%>36</td> <td width=23%>1200</td> </tr></table>");
s++; item[s]=new Array("shackles_8__snap_shackles.html","../images/shacklesnapholtfixedeyetmb.jpg","Shackles &#187 8. Snap shackles","£4.99 &#187 Snap Shackle code ht64000","<p>Technical Data </p><ul> <li>Forging material: AISI316 - DIN 1.4401 </li> <li>Casting Material: AISI316 - DIN 1.4408 </li> <li>Surface Treatment: E.P. (Electro polished) </li> <li>Breaking Load: Standard safety factor for working load is 1/4 of TDL (Tested deformation load) </li> <li>Application: Snap shackles are designed for applications where a permanent non-swivel action end is required. Snap shackle head are designed for assembly with external parts such as ball bearing blocks. </li></ul><ul> <li> <table width=68% border=1 height=95> <tr bordercolor=#3333FF bgcolor=#FFFFFF> <td width=14% height=9> <div align=center><b><font size=3>A/mm</font></b></div> </td> <td width=10% height=9> <div align=center><b><font size=3>B/mm</font></b></div> </td> <td width=12% height=9> <div align=center><b><font size=3>L/mm</font></b></div> </td> <td width=64% height=9> <div align=center><b><font size=3>Breaking load/kg</font></b></div> </td> </tr> <tr bordercolor=#3333FF bgcolor=#FFFFFF> <td width=14% height=5> <div align=center><b><font size=3>9.5</font></b></div> </td> <td width=10% height=5> <div align=center><b><font size=3>6.5</font></b></div> </td> <td width=12% height=5> <div align=center><b><font size=3>34</font></b></div> </td> <td width=64% height=5> <div align=center><b><font size=3>400</font></b></div> </td> </tr> </table> </li></ul>");
s++; item[s]=new Array("shackles_8__snap_shackles.html","../images/shacklesnapholtfixedeyetmb.jpg","Shackles &#187 8. Snap shackles","£5.99 &#187 Snap Shackle code ht64001","<p>Technical Data </p><ul> <li>Forging material: AISI316 - DIN 1.4401 </li> <li>Casting Material: AISI316 - DIN 1.4408 </li> <li>Surface Treatment: E.P. (Electro polished) </li> <li>Breaking Load: Standard safety factor for working load is 1/4 of TDL (Tested deformation load) </li> <li>Application: Snap shackles are designed for applications where a permanent non-swivel action end is required. Snap shackle head are designed for assembly with external parts such as ball bearing blocks. </li></ul><ul> <li> <table width=68% border=1 height=95> <tr bordercolor=#3333FF bgcolor=#FFFFFF> <td width=14% height=9> <div align=center><b><font size=3>A/mm</font></b></div> </td> <td width=10% height=9> <div align=center><b><font size=3>B/mm</font></b></div> </td> <td width=12% height=9> <div align=center><b><font size=3>L/mm</font></b></div> </td> <td width=64% height=9> <div align=center><b><font size=3>Breaking load/kg</font></b></div> </td> </tr> <tr bordercolor=#3333FF bgcolor=#FFFFFF> <td width=14% height=5> <div align=center><b><font size=3>11</font></b></div> </td> <td width=10% height=5> <div align=center><b><font size=3>16</font></b></div> </td> <td width=12% height=5> <div align=center><b><font size=3>99</font></b></div> </td> <td width=64% height=5> <div align=center><b><font size=3>1100</font></b></div> </td> </tr> </table> </li></ul>");
s++; item[s]=new Array("shackles_8__snap_shackles.html","../images/shacklesnapholtfixedeyetmb.jpg","Shackles &#187 8. Snap shackles","£5.99 &#187 Snap Shackle code ht64002","<p>Technical Data </p><ul> <li>Forging material: AISI316 - DIN 1.4401 </li> <li>Casting Material: AISI316 - DIN 1.4408 </li> <li>Surface Treatment: E.P. (Electro polished) </li> <li>Breaking Load: Standard safety factor for working load is 1/4 of TDL (Tested deformation load) </li> <li>Application: Snap shackles are designed for applications where a permanent non-swivel action end is required. Snap shackle head are designed for assembly with external parts such as ball bearing blocks. </li></ul><ul> <li> <table width=68% border=1 height=95> <tr bordercolor=#3333FF bgcolor=#FFFFFF> <td width=14% height=9> <div align=center><b><font size=3>A/mm</font></b></div> </td> <td width=10% height=9> <div align=center><b><font size=3>B/mm</font></b></div> </td> <td width=12% height=9> <div align=center><b><font size=3>L/mm</font></b></div> </td> <td width=64% height=9> <div align=center><b><font size=3>Breaking load/kg</font></b></div> </td> </tr> <tr bordercolor=#3333FF bgcolor=#FFFFFF> <td width=14% height=5> <div align=center><b><font size=3>13.5</font></b></div> </td> <td width=10% height=5> <div align=center><b><font size=3>21</font></b></div> </td> <td width=12% height=5> <div align=center><b><font size=3>30</font></b></div> </td> <td width=64% height=5> <div align=center><b><font size=3>2000</font></b></div> </td> </tr> </table> </li></ul>");
s++; item[s]=new Array("shackles_8__snap_shackles.html","../images/shacklesnapholtswiveleyetmb.jpg","Shackles &#187 8. Snap shackles","£5.99 &#187 Snap Shackle swivel eye code ht64201","<p>Technical Data </p><ul> <li>Forging material: AISI316 - DIN 1.4401 </li> <li>Casting Material: AISI316 - DIN 1.4408 </li> <li>Surface Treatment: E.P. (Electro polished) </li> <li>Breaking Load: Standard safety factor for working load is 1/4 of TDL (Tested deformation load) </li> <li>Application: Stamping jaw and Casting jaw of snap shackles are designed for application where a simple light load version of a quick open/assembly pin is required. Swivel eye snap shackles are designed for applications where a free swivel action end is required. </li></ul><ul> <li> <table width=68% border=1 height=95> <tr bordercolor=#3333FF bgcolor=#FFFFFF> <td width=16% height=9> <div align=center><b><font size=3>A/mm</font></b></div> </td> <td width=15% height=9><b><font size=3>C/mm</font></b></td> <td width=15% height=9> <div align=center><b><font size=3>L/mm</font></b></div> </td> <td width=36% height=9> <div align=center><b><font size=3>Breaking load/kg</font></b></div> </td> </tr> <tr bordercolor=#3333FF bgcolor=#FFFFFF> <td width=16% height=5> <div align=center><b><font size=3>12</font></b></div> </td> <td width=15% height=5>12</td> <td width=15% height=5> <div align=center><b><font size=3>70</font></b></div> </td> <td width=36% height=5> <div align=center><b><font size=3>1100</font></b></div> </td> </tr> </table> </li></ul>");
s++; item[s]=new Array("shackles_8__snap_shackles.html","../images/shacklesnapholtswiveleyetmb.jpg","Shackles &#187 8. Snap shackles","£6.99 &#187 Snap Shackle swivel eye code ht64202","<p>Technical Data </p><ul> <li>Forging material: AISI316 - DIN 1.4401 </li> <li>Casting Material: AISI316 - DIN 1.4408 </li> <li>Surface Treatment: E.P. (Electro polished) </li> <li>Breaking Load: Standard safety factor for working load is 1/4 of TDL (Tested deformation load) </li> <li>Application: Stamping jaw and Casting jaw of snap shackles are designed for application where a simple light load version of a quick open/assembly pin is required. Swivel eye snap shackles are designed for applications where a free swivel action end is required. </li></ul><ul> <li> <table width=68% border=1 height=95> <tr bordercolor=#3333FF bgcolor=#FFFFFF> <td width=16% height=9> <div align=center><b><font size=3>A/mm</font></b></div> </td> <td width=15% height=9><b><font size=3>C/mm</font></b></td> <td width=15% height=9> <div align=center><b><font size=3>L/mm</font></b></div> </td> <td width=36% height=9> <div align=center><b><font size=3>Breaking load/kg</font></b></div> </td> </tr> <tr bordercolor=#3333FF bgcolor=#FFFFFF> <td width=16% height=5> <div align=center><b><font size=3>16</font></b></div> </td> <td width=15% height=5>16</td> <td width=15% height=5> <div align=center><b><font size=3>87</font></b></div> </td> <td width=36% height=5> <div align=center><b><font size=3>2000</font></b></div> </td> </tr> </table> </li></ul>");
s++; item[s]=new Array("shackles_8__snap_shackles.html","../images/optipartssparssailsfittings1372tmb.jpeg","Shackles &#187 8. Snap shackles","£7.50 &#187 Optimist Trigger Snap Safety Snap Shackle","Stainless steel 316 trigger snap safety snap shackle. Can be opened with one hand. Length 49 mm, weights 20 gr.");
s++; item[s]=new Array("shackles_8__snap_shackles.html","../images/optipartssparssailsfittings1371tmb.jpeg","Shackles &#187 8. Snap shackles","£5.99 &#187 Optimist Stainless Seel Safety Snap Shackle","Small stainless steel safety snap shackle for the mainsheet. Length 43 mm, weighs just 16 grams.");
s++; item[s]=new Array("toe_straps_laser.html","../images/magicmarinelaser1toestrapracestd08tmb.jpg","Toe straps &#187 Laser","£15.99 &#187 Magic Marine Toestrap","Two options 7.5cm wide or 10.5cm wide");
s++; item[s]=new Array("toe_straps_laser.html","../images/lasersparesnewzealandpaddedtoestraptmb.jpg","Toe straps &#187 Laser","£21.00 &#187 New Zealand padded toestrap","");
s++; item[s]=new Array("toe_straps_optimist.html","../images/magicmarineoptimisthikingstrapstmb.jpg","Toe straps &#187 Optimist","£14.99 &#187 Optimist Magic Marine hiking straps","");
s++; item[s]=new Array("toe_straps_topper.html","../images/topperhullanddeckfittingsc5atstrapassembwplatestmb.gif","Toe straps &#187 Topper","£9.95 &#187 Topper centre Toestrap Assembly","");
s++; item[s]=new Array("toe_straps_topper.html","../images/topperhullanddeckfittingscentretoestrapw38atmb.gif","Toe straps &#187 Topper","£11.95 &#187 Topper side Toestrap Assembly","");
s++; item[s]=new Array("toe_straps_topper.html","../images/topperaccessoriesw12btmb.gif","Toe straps &#187 Topper","£22.95 &#187 Topper Padded Centre Toestrap","");
s++; item[s]=new Array("toe_straps_topper.html","../images/topperaccessoriesw13btmb.gif","Toe straps &#187 Topper","£44.95 &#187 Topper Padded Side Toestraps (Pair)","");
s++; item[s]=new Array("toe_straps_universal.html","../images/magicmarinelighttoestraptmb.jpg","Toe straps &#187 Universal","£12.50 &#187 Magic Marine light toe strap","<p>Description: </p><ul> <li>- Adjustable Footstrap</li> <li> - Lightweight, Dry less then 90gr. Wet less then 110gr. </li> <li>- Easy Entry </li> <li>- Can be opened completely in a safety situation </li></ul>");
s++; item[s]=new Array("toe_straps_universal.html","../images/mauimagicfootstrapdeluxetmb.jpg","Toe straps &#187 Universal","£9.99 &#187 Footstrap deluxe","");
s++; item[s]=new Array("toe_straps_universal.html","../images/dakinecontourbackfootstraptmb.jpg","Toe straps &#187 Universal","£15.00 &#187 Da kine contour footstrap - front","");
s++; item[s]=new Array("toe_straps_universal.html","../images/dakinecontourforntfootstraptmb.jpg","Toe straps &#187 Universal","£15.00 &#187 Da kine contour footstrap - back","");
s++; item[s]=new Array("trailers_&_accessories_accessories.html","../images/traileaccesscableplugattachmenttmb.jpg","Trailers & accessories &#187 Accessories","£2.99 &#187 Cable plug attachment","");
s++; item[s]=new Array("trailers_&_accessories_accessories.html","../images/traileaccessplastictowbarplugtmb.jpg","Trailers & accessories &#187 Accessories","£4.99 &#187 Tow bar plug plastic","");
s++; item[s]=new Array("trailers_&_accessories_accessories.html","../images/traileaccessmetaltowbarplugtmb.jpg","Trailers & accessories &#187 Accessories","£6.99 &#187 Tow bar plug metal","");
s++; item[s]=new Array("trailers_&_accessories_accessories.html","../images/traileaccessmudguardtmb.jpg","Trailers & accessories &#187 Accessories","£6.99 &#187 Mud guard for trailer - plastic for 8 inch wheels","");
s++; item[s]=new Array("trailers_&_accessories_accessories.html","../images/traileaccessmudguardtmb.jpg","Trailers & accessories &#187 Accessories","£8.99 &#187 Mud guard for trailer - plastic for 10 inch wheels","");
s++; item[s]=new Array("trailers_&_accessories_accessories.html","../images/traileaccesssafetyleash1tmb.jpg","Trailers & accessories &#187 Accessories","£7.99 &#187 Safety leash standard","");
s++; item[s]=new Array("trailers_&_accessories_accessories.html","../images/traileaccessplastictowbarplugtmb.jpg","Trailers & accessories &#187 Accessories","£12.99 &#187 Safety leash heavy duty","");
s++; item[s]=new Array("trailers_&_accessories_accessories.html","../images/traileaccess3ftlightingbdtmb.jpg","Trailers & accessories &#187 Accessories","£22.99 &#187 3 foot lighting board 4m cable","");
s++; item[s]=new Array("trailers_&_accessories_accessories.html","../images/traileaccess6ftlightingbdtmb.jpg","Trailers & accessories &#187 Accessories","£24.99 &#187 4 foot lighting board 7m cable","");
s++; item[s]=new Array("trailers_&_accessories_accessories.html","../images/traileaccess6ftlightingbdtmb.jpg","Trailers & accessories &#187 Accessories","£37.99 &#187 6 foot lighting board10m cable","");
s++; item[s]=new Array("trailers_&_accessories_accessories.html","../images/traileaccesslightingboardholderandmastsupporttmb.jpg","Trailers & accessories &#187 Accessories","£47.99 &#187 Lighting board holder and mast support","Lighting board holder and mast support DINGHY MAST SUPPORT Designed to support the aft end of dinghy masts when towing. Simply fits onto transom fittings and is instantly ready for use. Fully adjustable for different transom heights and has removable pintles to accommodate different layouts. The cross strap will accept lighting boards. The yolk has tie down eyes and a soft neoprene pad to protecxt the mast Fully adjustable to fit existing transom fittings and transom height. Adjust bottom fitting and height of yolk to suit transom fittings and transom height, then tighten locking nut. Remove bottom pintile if transom has two gudgeons. Attach trailer lighting board to cross plate using 2x6mm fastenings. Generous eyelets allow fo attachment of securing line.");
s++; item[s]=new Array("trailers_&_accessories_launch_trolley.html","../images/optipartslaunchtrolleytmb.gif","Trailers & accessories &#187 Launch trolley","£148.99 &#187 Optiparts launch trolley with large wheels","Please note this item is normally for collection only.If you would like us to quote for delivery please contact us.");
s++; item[s]=new Array("trailers_&_accessories_launch_trolley.html","../images/launchtrolleywmesarc22tstatmb.jpg","Trailers & accessories &#187 Launch trolley","£232.50 &#187 Launch trolley c220 standard for boats up to 12 feet long c22tsta.This comes in kit form.","Please note this item is normally for collection only.If you would like us to quote for delivery please contact us.");
s++; item[s]=new Array("trailers_&_accessories_launch_trolley.html","../images/trailerwestmersea220toppertmb.jpg","Trailers & accessories &#187 Launch trolley","£232.50 &#187 Launch trolley c220 standard for boats up to 12 feet long","Please note this item is normally for collection only.If you would like us to quote for delivery please contact us.");
s++; item[s]=new Array("trailers_&_accessories_launch_trolley.html","../images/trailerwestmerseac25tla1tmb.jpg","Trailers & accessories &#187 Launch trolley","£245.50 &#187 C25 TLA Laser Gunwhale Hung Laser 1 launch trolley","Please note this item is normally for collection only.If you would like us to quote for delivery please contact us.");
s++; item[s]=new Array("trailers_&_accessories_launch_trolley.html","../images/trailerwestmerseac27tstatmb.jpg","Trailers & accessories &#187 Launch trolley","£257.99 &#187 Launch trolley c27tsta for boats up to sixteen feet long","Please note this item is normally for collection only.If you would like us to quote for delivery please contact us.");
s++; item[s]=new Array("trailers_&_accessories_launch_trolley.html","../images/trailerwestmerseac27twayfarertmb.jpg","Trailers & accessories &#187 Launch trolley","£271.99 &#187 Launch trolley c27twayfarer designed for wayfarers","Please note this item is normally for collection only.If you would like us to quote for delivery please contact us.");
s++; item[s]=new Array("trailers_&_accessories_rack_pads_&_straps.html","../images/northshorerrpadshawjontitmb.jpg","Trailers & accessories &#187 Rack pads & straps","£8.99 &#187 North Shore Rackpads Hawaii 1 pair","");
s++; item[s]=new Array("trailers_&_accessories_rack_pads_&_straps.html","../images/magicmarineroofrackstrapstmb.jpg","Trailers & accessories &#187 Rack pads & straps","£11.99 &#187 Roof rack straps 1 pair","4.5m long 35mm wide");
s++; item[s]=new Array("trailers_&_accessories_rack_pads_&_straps.html","../images/magicmarineroofrackstrapstmb.jpg","Trailers & accessories &#187 Rack pads & straps","£11.99 &#187 Roof rack straps 1 pair","4.5m long 35mm wide");
s++; item[s]=new Array("trailers_&_accessories_rack_pads_&_straps.html","../images/animalroofrackpadstmb.jpg","Trailers & accessories &#187 Rack pads & straps","£12.99 &#187 Animal Roof Rack pads","");
s++; item[s]=new Array("trailers_&_accessories_road_base.html","../images/trailerwestmersearb250rbpgtmb.jpg","Trailers & accessories &#187 Road base","£448.50 &#187 RB 250 RB Road base for boats up to fifteen feet long","Please note this item is normally for collection only.If you would like us to quote for delivery please contact us.");
s++; item[s]=new Array("trailers_&_accessories_road_base.html","../images/trailerwestmersearb275rbpgtmb.jpg","Trailers & accessories &#187 Road base","£448.50 &#187 RB 275 RB For boats up to sixteen feet long","Please note this item is normally for collection only.If you would like us to quote for delivery please contact us.");
s++; item[s]=new Array("trailers_&_accessories_wheels_and_spares.html","../images/traileaccesslaunchtrolleywheeltmb.jpg","Trailers & accessories &#187 Wheels and spares","£16.50 &#187 Pneumatic launch trolley wheel","");
s++; item[s]=new Array("trailers_&_accessories_wheels_and_spares.html","../images/traileaccesssolidjockeywheeltmb.jpg","Trailers & accessories &#187 Wheels and spares","£19.00 &#187 solid jockey wheel by green tyre","");
s++; item[s]=new Array("trailers_&_accessories_wheels_and_spares.html","../images/traileaccessgreentyretmb.jpg","Trailers & accessories &#187 Wheels and spares","£24.99 &#187 Green tyre solid puncture proof launch trolley wheel","");
s++; item[s]=new Array("trailers_&_accessories_wheels_and_spares.html","../images/traileraccessjockeywheelsolidtyretmb.jpg","Trailers & accessories &#187 Wheels and spares","£29.99 &#187 jockey wheel with solid tyre height adjustable","");
s++; item[s]=new Array("trailers_&_accessories_wheels_and_spares.html","../images/traileaccess8rbwheeltmb.jpg","Trailers & accessories &#187 Wheels and spares","£30.55 &#187 8 inch road base wheel","");
s++; item[s]=new Array("trailers_&_accessories_wheels_and_spares.html","../images/traileaccess10rbasewheeltmb.jpg","Trailers & accessories &#187 Wheels and spares","£42.99 &#187 10 inch road base wheel","");
s++; item[s]=new Array("trailers_&_accessories_wheels_and_spares.html","../images/trailersparesimplejockeywheeltmb.jpg","Trailers & accessories &#187 Wheels and spares","£50.00 &#187 Simple jockey wheel with pneumatic tyre","");
s++; item[s]=new Array("trailers_&_accessories_wheels_and_spares.html","../images/traileraccessjockeywheelpneumatictyretmb.jpg","Trailers & accessories &#187 Wheels and spares","£49.99 &#187 jockey wheel with pneumatic tyre height adjustable","");
s++; item[s]=new Array("trailers_&_accessories_wheels_and_spares.html","../images/traileaccessdeluxejockeywheeltmb.jpg","Trailers & accessories &#187 Wheels and spares","£69.99 &#187 deluxe jockey wheel with handle","");
s++; item[s]=new Array("trapezes_&_hikers_accessories.html","../images/magicmarinesafetyknifetmb.jpg","Trapezes & hikers &#187 Accessories","£6.99 &#187 Magic Marine Knife in pocket","Magic Marine Knife in pocket");
s++; item[s]=new Array("trapezes_&_hikers_accessories.html","../images/magicmarinesafetyspreaderbartmb.jpg","Trapezes & hikers &#187 Accessories","£37.99 &#187 Magic Marine Standard release spreader bar","Magic Marine Standard release spreader bar");
s++; item[s]=new Array("trapezes_&_hikers_accessories.html","../images/magicmarinestdspreaderbartmb.jpg","Trapezes & hikers &#187 Accessories","£22.99 &#187 Magic Marine Standard standard spreader bar","Magic Marine Standard standard spreader bar");
s++; item[s]=new Array("trapezes_&_hikers_accessories.html","../images/magicmarinespreaderqrhooktmb.jpg","Trapezes & hikers &#187 Accessories","£13.50 &#187 Magic Marine Replacement Hook for Quick release spreader","Magic Marine Replacement Hook for Quick release spreader");
s++; item[s]=new Array("trapezes_&_hikers_hikers_adult.html","../images/neilprydehikeradulttmb.jpg","Trapezes & hikers &#187 Hikers adult","£89.99 &#187 Neil Pryde Race 5000 3mm pro hiker","<p>Neil Pryde 5000 Race Hiking Shorts </p><p>Features </p><ul> <li>Solid Pre formed removable Pads </li> <li> ¾ length leg with SCS seals </li> <li> Adjustable braces </li> <li> Armortex seat panel </li> <li> AirPrene Breathable back section </li></ul>");
s++; item[s]=new Array("trapezes_&_hikers_hikers_adult.html","../images/magicmarineenergyhikingshortjohntmb.jpg","Trapezes & hikers &#187 Hikers adult","£74.99 &#187 Magic Marine Energy Hiking Short John","<p>Short john and hiking Pant in one</p><ul> <li> Adjustable integrated battens </li> <li>Superflex Neoprene </li> <li>DWR technology </li> <li>Easy entry shoulder straps </li> <li>Powertex seatpart </li> <li>Relieve hole </li> <li>X-motion self centrating </li> <li>Kneepads PT kneepads 3/4 legs </li></ul>");
s++; item[s]=new Array("trapezes_&_hikers_hikers_adult.html","../images/gulfulllengthhikerstmb.jpg","Trapezes & hikers &#187 Hikers adult","£54.99 &#187 Gul Full length hikers code 0293","<p>Product Features: </p><ul> <li>3mm Dura Flex neoprene panels</li> <li> Adjustable elasticated shoulder straps </li> <li>High waist to reduce drag </li> <li>Fixed heavy duty baton pads </li> <li>Dura Tex seat and knees </li> <li>Durable mauser taped seams </li> <li>Articulated Knee </li></ul>");
s++; item[s]=new Array("trapezes_&_hikers_hikers_adult.html","../images/gulkinetichikerstmb.jpg","Trapezes & hikers &#187 Hikers adult","£29.99 &#187 Gul Kinetic","");
s++; item[s]=new Array("trapezes_&_hikers_hikers_adult.html","../images/magicmarinemagfreedompanttmb.jpg","Trapezes & hikers &#187 Hikers adult","£32.50 &#187 Magic Marine Freedom Pants","");
s++; item[s]=new Array("trapezes_&_hikers_hikers_adult.html","../images/magicmarinefreedompant09tmb.jpg","Trapezes & hikers &#187 Hikers adult","£38.50 &#187 Magic Marine Freedom Pants","");
s++; item[s]=new Array("trapezes_&_hikers_hikers_adult.html","../images/mmenergypantkneetmb.jpg","Trapezes & hikers &#187 Hikers adult","£64.99 &#187 Magic Marine Energy Hiking Pant with Knee","DURAFLEX Neoprene - POWERTEX seat part - Mausered flat seams stitching - Adjustable shoulder straps - New adjustable internal batten pads - Padded Powertex kneepads - Metalite O-ring leg seal");
s++; item[s]=new Array("trapezes_&_hikers_hikers_adult.html","../images/magicmarinecomppantlightkneeetmb.jpg","Trapezes & hikers &#187 Hikers adult","£74.99 &#187 Competition pant light with knee","");
s++; item[s]=new Array("trapezes_&_hikers_hikers_jnr.html","../images/mmenergypantkneetmb.jpg","Trapezes & hikers &#187 Hikers jnr","£64.99 &#187 Magic Marine Energy Hiking Pant with Knee","DURAFLEX Neoprene - POWERTEX seat part - Mausered flat seams stitching - Adjustable shoulder straps - New adjustable internal batten pads - Padded Powertex kneepads - Metalite O-ring leg seal");
s++; item[s]=new Array("trapezes_&_hikers_hikers_jnr.html","../images/neilprydejuniorhikerstmb.jpg","Trapezes & hikers &#187 Hikers jnr","£59.99 &#187 Neil Pryde Race 5000 3mm pro hiker","<p>Neil Pryde 5000 Race Hiking Shorts </p><p>Features </p><ul> <li> 3mm Duraflex Neoprene with GBS seams </li> <li> Fixed batten protection </li> <li> Adjustable elasticated braces </li> <li> ¾ leg with SCS seals </li></ul>");
s++; item[s]=new Array("trapezes_&_hikers_hikers_jnr.html","../images/magicmarinefreedompant09tmb.jpg","Trapezes & hikers &#187 Hikers jnr","£38.50 &#187 Magic Marine Junior Freedom Pants","");
s++; item[s]=new Array("trapezes_&_hikers_hikers_jnr.html","../images/crewsaver isthmushikingshortstmb.jpg","Trapezes & hikers &#187 Hikers jnr","£59.99 &#187 Crewsaver Isthmus Hiker","<ul> <li> Battened 3mm Neoprene hiking shorts for improved racing performance </li> <li>Three quarter length leg with reinforced knees and seat </li> <li>Low cut body with adjustable shoulder straps </li> <li>Padded stiffeners for support against the side deck/gunwhale </li></ul>");
s++; item[s]=new Array("trapezes_&_hikers_trapeze_adult.html","../images/magicmarinerevolutionharnesstmb.jpg","Trapezes & hikers &#187 Trapeze Adult","£99.00 &#187 Magic Marine Revolution Harness","<p>The Revolution and Galaxy harnesses are the result of cross-over techniques never used before in harness technology. The biggest change compared to conventional harnesses is in the ‘Revolution badge'.The Revolution badge is a 3-dimensional injection moulded part that forms the skeleton of the harness. The badge follows the shape of the body like never before. For the creation of it we used life models, vacuum moulding, CNC shaping and computer aided design. All to deliver support and comfort.Apart from it's key technology the Revolution is built for sailing on any level in any circumstance. </p><ul> <li>Revolution Badge 3D technology </li> <li>Webbing cover Bar ROM system</li> <li> Motion leg straps </li> <li>Ventilation mesh </li> <li>Thermo moulded foam </li> <li>Reinforced seat part </li> <li>HD shoulder closure </li></ul>");
s++; item[s]=new Array("trapezes_&_hikers_trapeze_adult.html","../images/magicmarineprotrapezeharnesstmb.jpg","Trapezes & hikers &#187 Trapeze Adult","£59.99 &#187 Magic Marine Pro Harness","XS/s available in black , s/m available in red or blue");
s++; item[s]=new Array("trapezes_&_hikers_trapeze_adult.html","../images/magicmarinetrapezeharnesssmarttmb.jpg","Trapezes & hikers &#187 Trapeze Adult","£62.50 &#187 Magic Marine Smart Harness","<ul> <li> Description: </li> <li>- Pre-Shaped Shoulder Straps </li> <li>- Covered Buckles </li> <li>- Adjustable Back Support </li> <li>- Neoprene Padded Leg Straps </li> <li>- Tube Spreader </li></ul>");
s++; item[s]=new Array("trapezes_&_hikers_trapeze_adult.html","../images/magicmarinetrapezeharnesssmarttmb.jpg","Trapezes & hikers &#187 Trapeze Adult","£62.50 &#187 Magic Marine Smart Harness","<ul> <li> Description: </li> <li>- Pre-Shaped Shoulder Straps </li> <li>- Covered Buckles </li> <li>- Adjustable Back Support </li> <li>- Neoprene Padded Leg Straps </li> <li>- Tube Spreader </li></ul>");
s++; item[s]=new Array("trapezes_&_hikers_trapeze_adult.html","../images/magicmarinetrapezeharnessskifflighttmb.jpg","Trapezes & hikers &#187 Trapeze Adult","£69.99 &#187 Magic Marine Skiff Light Harness","<ul> <li> Description: </li> <li>- Less then 1KG with Release Skiff Plate</li> <li> - Release Skiff Plate </li> <li>- Adjustable Back Support</li> <li> - Kevlar Seat Part </li> <li>- 600D Polyester</li> <li> - Knife </li></ul>");
s++; item[s]=new Array("trapezes_&_hikers_trapeze_adult.html","../images/magicmarinetrapezeharnessultimatetmb.jpg","Trapezes & hikers &#187 Trapeze Adult","£114.99 &#187 Magic Marine Ultimate Harness","<ul> <li> Description: </li> <li>- Release Adjuster Spreader</li> <li> - First Sailing Harness with 3 different setups</li> <li> - Eight part Fixation </li> <li>- Heavy rip-stop Polyester & PVC Fabric</li> <li> - Pre-Shaped Neoprene Shoulder Padding </li> <li>- 3D-Thermo Moulded Foam Back Panel </li> <li>- 4 Internal Back Support Battens </li> <li>- Pre-Shaped Internal Side Pads </li> <li>- Motion Neoprene Leg Straps </li> <li>- Pre-Shaped Kevlar Seat Section - Knife </li></ul>");
s++; item[s]=new Array("trapezes_&_hikers_trapeze_jnr.html","../images/magicmarinetrapezeharnesssmarttmb.jpg","Trapezes & hikers &#187 Trapeze jnr","£59.99 &#187 Magic Marine Smart Junior Harness","<ul> <li> Description: </li> <li>- Pre-Shaped Shoulder Straps </li> <li>- Covered Buckles </li> <li>- Adjustable Back Support </li> <li>- Neoprene Padded Leg Straps </li> <li>- Tube Spreader </li></ul>");
s++; item[s]=new Array("trapezes_&_hikers_trapeze_ladies.html","../images/magicmarinegalaxyracingharnesstmb.jpg","Trapezes & hikers &#187 Trapeze Ladies","£79.00 &#187 Magic Marine Galaxy Racing Harness for ladies","<p>The Revolution and Galaxy harnesses are the result of cross-over techniques never used before in harness technology. The biggest change compared to conventional harnesses is in the ‘Revolution badge'.The Revolution badge is a 3-dimensional injection moulded part that forms the skeleton of the harness. The badge follows the shape of the body like never before. For the creation of it we used life models, vacuum moulding, CNC shaping and computer aided design. All to deliver support and comfort.Apart from it's key technology the Revolution is built for sailing on any level in any circumstance.</p><ul> <li> Quick Release spreader </li> <li>Integrated knife </li> <li>Lightweight plain harness</li> <li> Heavy polyester </li> <li>Back support battens </li> <li>Batten-end load distribution plates </li> <li>Covered buckles</li> <li> Buckle release ropes </li> <li>Elastic webbing cover </li> <li>Padded leg straps </li></ul>");
s++; item[s]=new Array("trapezes_&_hikers_trapeze_ladies.html","../images/magicmarineracingharnesstmb.jpg","Trapezes & hikers &#187 Trapeze Ladies","£69.99 &#187 Magic Marine RACING Ladies Harness","<p>Description: </p><ul> <li>- Release Spreader - Integrated Knife </li> <li>- Lightweight Plain Harness </li> <li>- Heavy Polyester </li> <li>- Back Support Battens </li> <li>- Batten-end Load Distribution Plates </li> <li>- Covered Buckles </li> <li>- Buckle Release Ropes </li> <li>- Elastic Webbing Cover </li> <li>- Padded Leg Straps </li></ul>");
s++; item[s]=new Array("trapezes_&_hikers_trapeze_ladies.html","../images/magicmarineladiesregattaharnesstmb.jpg","Trapezes & hikers &#187 Trapeze Ladies","£84.99 &#187 Magic Marine Ladies Regatta Harness","<p>Description:</p><ul> <li> - Release Spreader </li> <li>- Integrated Knife </li> <li>- Pre-Shaped Shoulder Straps </li> <li>- Neoprene Shoulder Padding</li> <li> - 3D Moulded Back Panel </li> <li>- Covered Buckles </li> <li>- Buckle Release Ropes </li> <li>- Neoprene Leg Straps </li> <li>- Kevlar Seat Part </li> <li>- Adjustable Back Support </li></ul>");
s++; item[s]=new Array("wind_indicators_burgee.html","../images/falkerburgheetmb.jpg","Wind indicators &#187 Burgee","£6.99 &#187 Racing burghee flag size 110 by 120 mm stem 42cm","");
s++; item[s]=new Array("wind_indicators_burgee.html","../images/holtallenburgheeracelongstemtmb.jpg","Wind indicators &#187 Burgee","£6.99 &#187 Racing burghee flag size 110 by 120 mm stem 42cm","");
s++; item[s]=new Array("wind_indicators_burgee.html","../images/optipartsburgeetmb.jpg","Wind indicators &#187 Burgee","£7.50 &#187 Optimist Racing Wind Indication","");
s++; item[s]=new Array("wind_indicators_hawks.html","../images/hawkmouldingslittlehawkmk1tmb.gif","Wind indicators &#187 Hawks","£7.98 &#187 little hawk mk1","<p>The Little Hawk MK1 is a small lightweight and robust Wind Indicator designed to be positioned at the top of the mast on dinghies upto 6m. Very popular with Optimists and Toppers the Little Hawk MK1 is also ideal for any dinghy that wants accurate wind direction information with minimal weight and drag. The Vane Arm is made of super tough nylon and is all but indestructible. The aluminium rod can be easily straightened if damaged or easily bent to any required angle. The whole unit is easily assembled straight from the box. Use: Dinghy’s up to 6m.</p><ul> <li> Vane Arm Length: 16.5cm </li> <li>Overall Height: 28cm </li> <li>Overall Weight: 16gms</li> <li> Bearing: Aluminium Pin </li> <li>UV Protected: Yes </li> <li>Balanced Arm: By design </li></ul>");
s++; item[s]=new Array("wind_indicators_hawks.html","../images/hawkmouldingslittlehawkmk2tmb.gif","Wind indicators &#187 Hawks","£11.15 &#187 little hawk mk11","<p>The Little Hawk Mk2 brings all the benefits of the Little Hawk Mk1 Wind Indicator and mounts it in a secure manor at gooseneck height in front of the mast. Designed for smaller single handed Dinghies, the Little Hawk Mk2 allows quick and accurate reference to wind direction without having to look at the top of the mast. Ideal for upwind and downwind reference. The Little Hawk Mk2 is easily mounted and removed with a secure adjustable bracket. The aluminium support rod can be bent to any required angle, but is easily straightened if accidentally knocked. The complete unit removes for safe storage without any tools. The Little Hawk Mk2 is very popular with Topper and Laser Sailors. </p><ul> <li>Use: Dinghy’s up to 6m. </li> <li>Vane Arm Length: 16.5cm </li> <li>Overall Height: 19cm </li> <li>Overall Weight: 28gms </li> <li>Bearing: Aluminium Pin</li> <li> UV Protected: Yes </li> <li>Balanced Arm: By Design. </li></ul>");
s++; item[s]=new Array("wind_indicators_hawks.html","../images/hawkmouldingsstandardhawktmb.gif","Wind indicators &#187 Hawks","£17.89 &#187 hawk for sailboats up to 26 feet","<p>The Hawk is the original Hawk Wind Indicator and sets the standard by which all Wind Indicators are judged. Lightweight with a balanced arm and the Hawk “V” jewel bearing surface this is the ultimate in Wind Indicator Technology. The Vane arm is made from super tough Nylon giving good rigidity and UV Protection. The support rod is high grade aluminium allowing it to be bent if required or straightened should it be knocked or damaged. The easily removable mast clip can be mounted either vertically or horizontally and is easily removed without tools. Adjust and lock the reference arms at any angle for quick, at a glance indication, of either gybing or tacking angles. </p><ul> <li>Use: Dinghies, Dayboats, Sportsboats up to 8m. </li> <li>Vane Arm Length: 27cm </li> <li>Overall Height: 28cm </li> <li>Overall Weight: 25gms </li> <li>Bearing: “V” Jewel </li> <li>UV Protected: Yes </li> <li>Balanced Arm: Counter Weight. </li></ul>");
s++; item[s]=new Array("wind_indicators_hawks.html","../images/hawkracewindindicatortmb.jpg","Wind indicators &#187 Hawks","£18.82 &#187 Hawk race","<p>The Hawk Race brings all the benefits of the Hawk Wind Indicator and mounts it in a secure manor at gooseneck height in front of the mast. </p><p>Designed primarily for larger single handed Dinghies, the Hawk Race allows quick and accurate reference to wind direction without having to look at the top of the mast. </p><p>Ideal for both upwind and downwind reference. The Hawk Race is also easily mounted and removed with a secure adjustable bracket. The aluminium support rod is easily bent to any required angle, but easily straightened if accidentally knocked. </p><ul> <li>Use: Single Handed Racing Dinghies.</li> <li> Vane Arm Length: 27cm </li> <li>Overall Height: N/A </li> <li>Overall Weight: 32gms Bearing: </li> <li>“V” Jewel UV Protected: Yes</li> <li> Balanced Arm: Counter Weight </li></ul>");
s++; item[s]=new Array("wind_indicators_hawks.html","../images/hawkmouldingscathawktmb.gif","Wind indicators &#187 Hawks","£21.03 &#187 cat hawk","<p>The Cat Hawk is designed for non-spinnaker Catamarans up to 8m. It has been developed to mount onto the front of the Forestay Bridle where it is ideally situated for maximum visibility both upwind and downwind. The Cat Hawk uses the same Vane Arm as the Hawk with all the benefits of Balance, Weight and UV Protection that it brings. The Reference arms are specific to the Cat Hawk. These can be set up for either upwind angles or to judge the fastest downwind angles. The Support Rod is aluminium and has the Hawk quick mount/un-mount clip for quick rigging and de-rigging. </p><ul> <li>Use: Non Spinnaker Catamarans up to 8m. </li> <li>Vane Arm Length: 25cm </li> <li>Overall Height: N/A </li> <li>Overall Weight: 30gms</li> <li> Bearing: “V” Jewel </li> <li>UV Protected: Yes</li> <li> Balanced Arm: Counter Weight. </li></ul>");
s++; item[s]=new Array("wire_rigging_rigging_and_parts.html","../images/wireriggingcopperferruletmb.jpg","Wire Rigging &#187 Rigging and parts","£0.40 &#187 Copper ferrule","Copper ferrule");
s++; item[s]=new Array("wire_rigging_rigging_and_parts.html","../images/wireriggingthimbletmb.jpg","Wire Rigging &#187 Rigging and parts","£1.20 &#187 Thimble","Stainless steel thimble");
s++; item[s]=new Array("wire_rigging_rigging_and_parts.html","../images/wirerigging119wiretmb.jpg","Wire Rigging &#187 Rigging and parts","£1.55 &#187 Stainless steel wire 1/19 2mm priced per metre","Please note this price inlcudes swaging");
s++; item[s]=new Array("wire_rigging_rigging_and_parts.html","../images/wirerigging119wiretmb.jpg","Wire Rigging &#187 Rigging and parts","£1.60 &#187 Stainless steel wire 1/19 2.5mm priced per metre","Please note this price inlcudes swaging");
s++; item[s]=new Array("wire_rigging_rigging_and_parts.html","../images/wirerigging119wiretmb.jpg","Wire Rigging &#187 Rigging and parts","£1.70 &#187 Stainless steel wire 1/19 3mm priced per metre","Please note this price inlcudes swaging");
s++; item[s]=new Array("wire_rigging_rigging_and_parts.html","../images/wireriggingsofteyetmb.jpg","Wire Rigging &#187 Rigging and parts","£2.00 &#187 Soft eye","Please note this price inlcudes swaging");
s++; item[s]=new Array("wire_rigging_rigging_and_parts.html","../images/wirerigging119wiretmb.jpg","Wire Rigging &#187 Rigging and parts","£2.00 &#187 Stainless steel wire 1/19 3.5mm priced per metre","Please note this price inlcudes swaging");
s++; item[s]=new Array("wire_rigging_rigging_and_parts.html","../images/wirerigging119wiretmb.jpg","Wire Rigging &#187 Rigging and parts","£2.25 &#187 Stainless steel wire 1/19 4mm priced per metre","Please note this price inlcudes swaging");
s++; item[s]=new Array("wire_rigging_rigging_and_parts.html","../images/wirerigging719wiretmb.jpg","Wire Rigging &#187 Rigging and parts","£2.25 &#187 Stainless steel wire 7/19 2mm priced per metre","Please note this price inlcudes swaging");
s++; item[s]=new Array("wire_rigging_rigging_and_parts.html","../images/wirerigging719wiretmb.jpg","Wire Rigging &#187 Rigging and parts","£2.35 &#187 Stainless steel wire 7/19 2.5mm priced per metre","Please note this price inlcudes swaging");
s++; item[s]=new Array("wire_rigging_rigging_and_parts.html","../images/wirerigging719wiretmb.jpg","Wire Rigging &#187 Rigging and parts","£2.60 &#187 Stainless steel wire 7/19 3.0mm priced per metre","Please note this price inlcudes swaging");
s++; item[s]=new Array("wire_rigging_rigging_and_parts.html","../images/wirerigging719wiretmb.jpg","Wire Rigging &#187 Rigging and parts","£2.75 &#187 Stainless steel wire 7/19 3.5mm priced per metre","Please note this price inlcudes swaging");
s++; item[s]=new Array("wire_rigging_rigging_and_parts.html","../images/wirerigging719wiretmb.jpg","Wire Rigging &#187 Rigging and parts","£2.95 &#187 Stainless steel wire 7/19 4mm priced per metre","Please note this price inlcudes swaging");
s++; item[s]=new Array("wire_rigging_rigging_and_parts.html","../images/wireriggingthimbletmb.jpg","Wire Rigging &#187 Rigging and parts","£3.00 &#187 Hard eye","Please note this price inlcudes swaging");
s++; item[s]=new Array("wire_rigging_rigging_and_parts.html","../images/wirerigginghookterminal2mmstdtmb.jpg","Wire Rigging &#187 Rigging and parts","£3.60 &#187 Hook","Please note this price inlcudes swaging");
s++; item[s]=new Array("wire_rigging_rigging_and_parts.html","../images/wireriggingeyeswage30mmtmb.jpg","Wire Rigging &#187 Rigging and parts","£3.99 &#187 Swage eye","Please note this price inlcudes swaging");
s++; item[s]=new Array("wire_rigging_rigging_and_parts.html","../images/wireriggingforkswivelhead3mmtmb.jpg","Wire Rigging &#187 Rigging and parts","£3.99 &#187 Fork swivel head","Please note this price inlcudes swaging");
s++; item[s]=new Array("wire_rigging_rigging_and_parts.html","../images/wireriggingforkterminal25mmstdtmb.jpg","Wire Rigging &#187 Rigging and parts","£4.50 &#187 Fork","Please note this price inlcudes swaging");
s++; item[s]=new Array("wire_rigging_rigging_and_parts.html","../images/wireriggingtterminaltmb.jpg","Wire Rigging &#187 Rigging and parts","£5.00 &#187 T Terminal","Please note this price inlcudes swaging");
s++; item[s]=new Array("wire_rigging_rigging_and_parts.html","../images/wireriggingforktermial3mmtmb.jpg","Wire Rigging &#187 Rigging and parts","£16.00 &#187 Fork heavy duty","Please note this price inlcudes swaging");
s++; item[s]=new Array("wire_rigging_tension_gauges.html","../images/wireriggingloostensiongaugemodelatmb.jpg","Wire Rigging &#187 Tension gauges","£59.99 &#187 Loos Model A tension gauge 2.5mm,3mm,4mm","");
s++; item[s]=new Array("wire_rigging_tension_gauges.html","../images/wireriggingloostensiongaugetmb.jpg","Wire Rigging &#187 Tension gauges","£85.99 &#187 Loos Professional tension gauge 2.5mm,3mm,4mm","");